KEGG   Tsukamurella paurometabola: Tpau_3909Help
Entry
Tpau_3909         CDS       T01228                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParA CbiA
Motif
Other DBs
NCBI-ProteinID: ADG80481
UniProt: D5UMK7
Position
complement(4024004..4025071)
Genome map
AA seq 355 aa AA seqDB search
MRGIEIGMAVADGVLADDVRRAAAAAARTVTDVDRGQPRAAWASASGLVLDLESARVMAD
AARAGGLPRREGVALVATRAGLPELSAAVDVGASQVFELPEQVRELARFLAAREPDDGAR
SRVVAVLGGHGGAGASVLAAAVAVAAPGRGITALAVDADPWGGGIDLLLGCADLPGLRWG
DLALRGGHLPSEALVAALPGRADAVAVLSASGATAPEIPSEALLAVLDAGRRSVGITVVD
LPRRADPAVTACLDVADVVLLVCAATVRGCAAARSLSDGVLRRARSARLVVRGPSPGGLS
ARDVERAVGLPLLTSMRPQPGLDAQLDGNGLRLRKGSPLAAAAGRVLDGVRRSAA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcggggaatcgagatcggaatggccgtggccgacggtgtgctggccgacgatgtacgg
cgcgccgctgcggccgcggcacgcaccgtcaccgacgtcgaccgggggcagccccgcgcg
gcctgggccagcgccagtggcctggtgctcgatctggagtcggcgcgagtgatggccgac
gccgctcgtgccggcggcttgccgcgacgggagggcgtggccctggtcgccacgcgtgcc
gggcttcccgaactcagcgccgccgtcgacgtcggtgcgtcgcaggtcttcgaactgccc
gagcaggttcgcgagctggcccggttcctcgcggcccgcgaacccgatgatggtgcgcgg
tcccgggtggtcgccgtgctcggtgggcacggcggggccggggcgtcggttctggccgct
gccgtggcggttgcggccccgggccgcggaatcacggcgctcgccgtggatgcggacccg
tggggcggcggcatcgatctgttgctcggatgcgccgatctcccgggcttgcgttggggt
gatctcgcgttgcgcggcggacatctgccgtcggaggcgctggtcgcagctctgccgggc
cgtgccgacgccgtggccgtgctctccgcgagcggagcgacggcgccggagatcccgtcg
gaggcgctgctcgcggtgctcgatgccggacggcgcagcgtggggatcaccgtcgtcgac
ctgccgcggcgtgccgacccggctgtcacggcctgtctcgacgtcgccgatgtggtgctc
ctcgtgtgcgcggccacggtgcgcggatgcgcggcggcccggtcgttgtccgacggggtg
ctccgccgggcccgttccgcccggttggtggtccgcgggccgtcgcccggcggactgtcg
gcgcgggacgtcgaacgcgcggtcggactgccgctgctcacgtcgatgcggccgcagcca
ggcctcgacgcccagctcgatggcaatggcctgcggctgcggaagggctcgccgctcgcg
gcagcggccggccgggtgctcgacggcgtccgccggagtgcggcatga

DBGET integrated database retrieval system