KEGG   Tsukamurella paurometabola: Tpau_3916Help
Entry
Tpau_3916         CDS       T01228                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00010  Glycolysis / Gluconeogenesis
tpr00620  Pyruvate metabolism
tpr00640  Propanoate metabolism
tpr00680  Methane metabolism
tpr01100  Metabolic pathways
tpr01110  Biosynthesis of secondary metabolites
tpr01120  Microbial metabolism in diverse environments
tpr01130  Biosynthesis of antibiotics
tpr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpau_3916
   00620 Pyruvate metabolism
    Tpau_3916
   00640 Propanoate metabolism
    Tpau_3916
  Energy metabolism
   00680 Methane metabolism
    Tpau_3916
Enzymes [BR:tpr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Tpau_3916
Lipid biosynthesis proteins [BR:tpr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Tpau_3916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N Phage_T4_gp36
Motif
Other DBs
NCBI-ProteinID: ADG80488
UniProt: D5UML4
Position
4032739..4034685
Genome map
AA seq 648 aa AA seqDB search
MTDSATSAYPPSADFAAQANTHGRELYDRAEADRLGFWAEQANRLDWDTPFGEVLDWSGA
PFAKWFVGGKLNVAYNCVDRHVIAGNGDRVAIHWVGEPGDTRDITYADLQAEVSRAANYL
SSLGLNAGDRIAIYMPMVPEAIVAMLACARLGLTHSVVFGGFSAGALRSRIDDAQAKVVI
TTDGQFRRGKPAPLKANVDEALDMDVDGAKATSVEKVIVVQRCTNDIDWHDRDVWWHESV
GAASPEHTPEAFDAEHPLFLLYTSGTTGKPKGIVHSSGGYLTQAAYTHYYLFDLKPEKDV
YWCTADIGWVTGHTYIVYGPLANGATQIVYEGTPNSPTEHRHFEIIEKYGVSIYYIAPTL
VRTFMKWGREIPDAHDLRSIRVLGSVGEPINPEAWRWYREVIGAGTAPIVDTWWQTETGA
AMVAPLPGTTTLKPGSAMEPVPGISANIVDDDGNSLPRGESGLLVLDEPWPAMLRGIWGD
PERFVDTYWSRYADQGWYFAGDGARYDEDGALWVLGRVDDVMNISGHRISTAEVESALVG
HPAVAEAAVVGASDATTGQAIAAFVILRQGVDDSDPDRLITEMTAQVSKDISPIAKPREI
NIVPELPKTRSGKIMRRLLRDVAEGRELGDTSTLVDPTVFENIRKRKS
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgactgattccgcgacctccgcgtacccgccctccgcagacttcgcagctcaggccaat
acccatggcagagaattgtacgaccgtgccgaagcagaccgcttgggattctgggccgag
caggcgaatcggctggattgggacaccccgttcggcgaggtcctggactggtcgggtgcc
cccttcgcgaagtggttcgtgggcggcaaactcaacgtggcgtacaactgtgtcgatcgg
cacgtgattgccggcaacggcgatcgagtggccatccactgggtcggcgaacccggcgat
actcgcgatatcacctacgccgacctgcaggccgaggtcagccgcgccgccaactacctc
agctcgctgggcctgaacgcgggcgaccgcatcgcgatctacatgccgatggtccccgag
gccatcgtcgcgatgctcgcctgtgcccgcctgggcctgacgcactccgtggtcttcggc
ggcttctccgcgggcgccctgcgctcgcgcatcgatgatgcccaggcgaaggtcgtgatc
accaccgacggtcagttccgtcgcggtaagcccgcaccgctcaaggcgaacgtcgacgag
gccctggacatggacgtcgacggtgcgaaagccacctcggtcgagaaggtcatcgtcgtg
cagcgatgcacgaacgacatcgactggcacgaccgggatgtgtggtggcacgagtcggtc
ggtgccgcgtcgccggagcacacccccgaggcgttcgacgccgagcaccctctgttcctg
ctgtacacctccggcaccaccggtaagcccaagggcatcgtgcacagctccggcggctac
ctcacccaggccgcgtacacgcactactacctcttcgacctcaagcccgagaaggacgtg
tactggtgcacggccgatatcggttgggtcaccgggcacacctacatcgtgtacggaccg
ctcgcgaacggtgccacccagatcgtctacgagggcaccccgaactcgccgacggaacac
cgtcatttcgagatcatcgagaagtacggcgtctcgatctactacatcgcccccaccctg
gtgcgcacgttcatgaagtggggcagggagattcccgatgcccacgacctccgttcgatc
cgcgtactcggttcggtgggcgagccgatcaatcccgaggcgtggcgctggtaccgcgag
gtgatcggtgcgggcaccgcacccatcgtcgatacctggtggcagacggagaccggtgcc
gccatggtcgccccgttgccgggtaccaccacactcaagcccggttcggcgatggagccg
gtccccggcatcagcgccaacatcgtcgatgacgacggaaacagtctgccccgtggcgaa
tccggcctcctcgtactcgacgagccgtggccggcgatgctgcgcggtatctggggcgat
ccggaacggttcgtggacacctactggtcgcgctacgccgatcagggctggtacttcgcg
ggcgacggtgcgcggtacgacgaggacggcgccctctgggtgctgggccgcgtggatgac
gtcatgaacatctcgggccaccggatctccaccgccgaagtcgaatcggcactcgtcggc
caccccgccgtcgccgaggccgccgtcgtgggcgcatccgatgcgaccaccggccaggcg
atcgcggcgttcgtcatcctccgccagggcgtggacgactccgatcccgacaggctgatc
accgagatgacggcacaggtctccaaggacatctccccgatcgccaagccgcgcgagatc
aacatcgtgcccgaactgccgaagacgcgctccggcaagatcatgcgccgcctcctccgc
gatgtggccgagggccgcgagctgggcgatacgtccacgctggtcgatcccaccgtcttc
gagaacattcggaagcgaaagagctag

DBGET integrated database retrieval system