KEGG   Tsukamurella paurometabola: Tpau_3920Help
Entry
Tpau_3920         CDS       T01228                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SnoaL_4 SnoaL_2 Lumazine_bd_2
Motif
Other DBs
NCBI-ProteinID: ADG80492
UniProt: D5UML8
Position
complement(4037339..4037863)
Genome map
AA seq 174 aa AA seqDB search
MTLDDVLARQEIHDVVLRYCRGIDRLDLDAVRECYHPGAVDHHTGFTGPVEEYVPWVRGQ
LASLGGTHHQIGNHLCEQLRDVAAVETYCTATHWSRPGADLQVHLTLGMRYVDRFERRGG
RWAIAERWAVTDWTRWENDLTGPLGVPEAGPPPGREGDDPVDLLRAHLLGRERS
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctcgatgacgtactggctcggcaggagattcacgatgtcgtgctgcgctactgc
cgcggtatcgaccggctcgacctcgacgcggtacgcgagtgctaccacccgggcgccgtc
gatcaccacaccgggttcaccggtccggtcgaggagtacgtaccttgggtacgcggccaa
ctcgcatcactcggtggcacgcaccatcagatcggcaatcatctgtgtgagcagttgcgg
gatgtcgccgcagtcgagacatattgcacggcaacgcattggtccaggccgggtgcggac
ctccaggtccatctgacgctggggatgcgctatgtggaccggttcgagcgccgcggtgga
cggtgggcgatcgcggagcgctgggccgtgaccgactggacgcgctgggagaacgatctg
acggggcccctcggcgtccccgaggcggggccgccgcctgggcgcgagggcgacgatccg
gtcgacctgctgcgcgctcacttactggggcgcgagcgttcgtag

DBGET integrated database retrieval system