KEGG   Tsukamurella paurometabola: Tpau_3921Help
Entry
Tpau_3921         CDS       T01228                                 

Definition
(GenBank) Uracil-DNA glycosylase superfamily
  KO
K03649  double-stranded uracil-DNA glycosylase [EC:3.2.2.28]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Tpau_3921
Enzymes [BR:tpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.28  double-stranded uracil-DNA glycosylase
     Tpau_3921
DNA repair and recombination proteins [BR:tpr03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Tpau_3921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ADG80493
UniProt: D5UML9
Position
4037908..4038480
Genome map
AA seq 190 aa AA seqDB search
MGFTREQLLAYAGTTVPDLVGPDCRLLFAGINPGLWTAATGAHFARPGNRFYPALYAAGI
TDHVIDASMGMREADREALIAAGVGITNVAPRATAKASELTPTELQDGGRALVSRVERIR
PRVLAVLGITAYRSAFGSPRATVGLQPDPLGSTQVWVLPNPSGLNAHETIDTLAAAYRSA
AAAAGVLTSL
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgggattcacacgcgagcaactcctggcgtacgcgggcacgacggtgcccgacctggtc
ggtccggactgccggctgctgttcgccggaatcaatccgggactgtggacggccgccacc
ggtgcccacttcgcccggcccggcaaccgcttctaccccgccctgtacgcggcaggcatc
accgatcacgtcatcgatgcgtcgatgggcatgcgcgaggcggatcgcgaggccctgatc
gcggccggcgtgggaatcaccaatgtcgctccgcgggccaccgcgaaggccagcgagctc
accccgacggaactgcaggacggcggtcgggcgctggtatctcgggtcgaacggattcgg
ccgcgcgtactcgccgtgctcggcatcactgcgtaccgatcggcattcgggtcgccacgc
gcaaccgtcggtctgcaaccggaccccctggggagtacccaggtatgggtactcccgaac
cccagcggcctcaacgcccacgagacgatcgacaccctggcggcggcgtaccggtccgcc
gccgcggcggcgggcgttctcacctcgctgtga

DBGET integrated database retrieval system