KEGG   Tsukamurella paurometabola: Tpau_3929Help
Entry
Tpau_3929         CDS       T01228                                 

Definition
(GenBank) Redoxin domain protein
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Redoxin AhpC-TSA Thioredoxin Thioredoxin_8
Motif
Other DBs
NCBI-ProteinID: ADG80501
UniProt: D5UMM7
Position
complement(4051975..4052652)
Genome map
AA seq 225 aa AA seqDB search
MTDREPAPLLPGEKPSRVSGTTRWVIVCAVIVVALVVAIWPRSGGSGPAPEPTGAPSASV
SPGELRAARDRAALAPCPTGGVPRGPLAGLRLDCLADGRTLDAGAFPDGLPVLVNVWAWW
CAPCRVELPALAEVARRGADKLTVLTVHADPNAAAALDLLTELKLTLPTVEDPQSKVATM
LGAPRVYPATILLRADGSVAKVHARPFTSVDDVTAAVRDDLGVVL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgcgaacccgcgccgctgttgccgggggagaagccgagccgcgtctccggc
accacccgctgggtgatcgtctgtgcggtgatcgtggtggcgctcgtcgtcgcgatctgg
ccccgcagcggcggctccggccccgcccccgagccgaccggcgcaccgtcggcgagcgtg
agccccggcgagttgcgggccgcccgcgaccgggcagcactcgccccctgcccgaccggt
ggcgtcccacgcggtccgctcgccgggctacggctggactgtctcgccgacggtcgcacg
ctggacgcgggcgccttcccggacgggctgccggtgctcgtcaacgtgtgggcctggtgg
tgcgcaccgtgccgtgtcgagcttcccgcactggccgaggtggcccgccgcggcgcggac
aagctgacggtgctcaccgtgcacgccgatcccaacgccgcggcggccctcgacctcctg
accgaactgaagctcacgctgcccaccgtcgaggacccgcaatcgaaggtcgcgaccatg
ctcggcgccccgcgtgtgtaccccgcaaccatcctgttacgtgccgatggcagtgtggcc
aaggtgcacgcgcgccccttcacctccgtcgacgatgtgaccgccgcggtccgcgacgac
ctcggggtggtcctgtga

DBGET integrated database retrieval system