KEGG   Tsukamurella paurometabola: Tpau_3935Help
Entry
Tpau_3935         CDS       T01228                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4177
Motif
Other DBs
NCBI-ProteinID: ADG80507
UniProt: D5UMN3
Position
complement(4055912..4056076)
Genome map
AA seq 54 aa AA seqDB search
MSEKTTWEYSTIPLLTHATKQILDTWGSDGWELVTVLPGPTGEQHVAYMKRPLG
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaagaccacctgggagtactccaccattccgctgctgacgcacgccaccaag
cagatcctcgacacctggggatccgacggctgggagctggtcacagtgctgccgggcccg
accggtgagcagcacgtcgcctacatgaagcggcctctcggatga

DBGET integrated database retrieval system