KEGG   Tsukamurella paurometabola: Tpau_3942Help
Entry
Tpau_3942         CDS       T01228                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT_3 4HBT
Motif
Other DBs
NCBI-ProteinID: ADG80514
UniProt: D5UMP0
Position
complement(4062638..4063420)
Genome map
AA seq 260 aa AA seqDB search
MSEVSPQFVRRGRGFDSLPAAEGRWAPGTLSGPAVAGLLAQVLDTEYGAGLVAARWHCDL
FRMVRAGHIEVRTRLVRSGRRIRVAEAEVIQDEAAVVRAAVTFYHRAPQPDGAVWCDPEV
PRAPVPVAPRLSMASGDSEYSTDPAQWLNAERKRVWAVGWRVLDGEETTPFARAAMVSDT
TNLVCGMGTGGVQTINGDVSMALARAPIGDEIGLEADHHMVIDGVSAASASMFDRAGRFG
VCTVTGVATGSAVHGPKESR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaggtcagcccccagttcgtccgtcgtggtcgtggattcgactctctccccgcg
gcggagggacggtgggcgcccggcaccctgtccggcccggctgtggccgggctgctcgcg
caggtcctcgacaccgaatacggcgcgggactcgtggccgcgcgctggcactgcgacctg
ttccgcatggtcagggccggccacatcgaggtccgcacccgcctcgtgcggtcgggccgg
cggattcgcgtcgccgaggccgaggtgatccaggacgaggcagccgtggtgcgcgccgcg
gtgaccttctatcaccgggcgccgcaacccgacggcgccgtctggtgcgatcccgaggtg
ccgcgcgcaccggtgcccgtggccccgcggctgtcgatggcgagtggcgacagcgagtac
agcaccgatccggcgcagtggctcaacgccgaacgcaagcgggtgtgggccgtgggctgg
cgggtgctcgacggcgaggagaccaccccgttcgcgcgcgccgcgatggtctcggacacc
acgaatctggtgtgcggcatgggaaccggtggggtgcagacgatcaacggagacgtgtcc
atggcgctcgcccgcgccccgatcggcgacgagatcggcctggaggccgatcatcacatg
gtgatcgacggtgtcagcgccgcctcggcgagcatgttcgaccgtgcgggccggttcgga
gtgtgcaccgtgaccggggtggccaccggatccgccgtccacgggccgaaggagtctcga
tga

DBGET integrated database retrieval system