KEGG   Tsukamurella paurometabola: Tpau_3946Help
Entry
Tpau_3946         CDS       T01228                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 DUF938
Motif
Other DBs
NCBI-ProteinID: ADG80518
UniProt: D5UMP4
Position
4066225..4066431
Genome map
AA seq 68 aa AA seqDB search
MPGDSLFARLWPSIVKNEPPRLTALRRENLTGLRGRVLEVGAGTGTNFGLYPPAVERIAA
LEPEARLP
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtgattccctgttcgcacgcctgtggccgtccatcgtgaagaacgaaccgccg
cggctcacggcgctgcgccgggagaacctcaccgggttacggggccgagtactcgaggta
ggtgccgggaccggcaccaacttcggtctgtatccgcccgcggtcgaacggatcgcggcg
ctcgaaccggaggcccgcctgccctga

DBGET integrated database retrieval system