KEGG   Tsukamurella paurometabola: Tpau_3949Help
Entry
Tpau_3949         CDS       T01228                                 

Definition
(GenBank) Transketolase domain protein
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00030  Pentose phosphate pathway
tpr01051  Biosynthesis of ansamycins
tpr01100  Metabolic pathways
tpr01110  Biosynthesis of secondary metabolites
tpr01120  Microbial metabolism in diverse environments
tpr01130  Biosynthesis of antibiotics
tpr01200  Carbon metabolism
tpr01230  Biosynthesis of amino acids
Module
tpr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
tpr_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:tpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tpau_3949
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Tpau_3949
Enzymes [BR:tpr01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Tpau_3949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ADG80521
UniProt: D5UMP7
Position
complement(4068783..4069799)
Genome map
AA seq 338 aa AA seqDB search
MTETQDQAEIFGGGATELRDKRSFDGSDVSSIPAFVFGEELADLADADPRIVVLTADLAS
ANRATDFAERHPDRFINMGIAEKGMITSAAGMASCGYVPFAATFASFSALLCAEQIRTDC
AYPRMPVRIVGHHSGMSMGFYGTSHHALEDLGVLRTFAELTVVCATDANHLRAILRASVD
HPGAMYIRLGRGRDPQVYSMVPDLTLGKSIRLREGSDLTIVATGTEVHPSLEAAEILAGE
GVSVRVVDMHTVAPLDVDEVLAAARETGAVLTVEEHNVTNGLGTAVAEALLLGGAPPVRF
AKHGVPDEYIPVGPPAALYAKYRLDAPGIAAVVREMVR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagacccaggaccaggccgagatcttcggcggcggcgccaccgagctccgcgat
aagcgctccttcgacggcagcgatgtcagctcgatccccgcgttcgtgttcggggaggaa
ctggccgacctggccgacgccgacccgcggatcgtcgtgctgaccgccgatctggccagc
gccaaccgcgccacggacttcgccgagcgccatcccgaccggttcatcaacatgggcatc
gcggagaagggcatgatcacctccgctgccgggatggcctcgtgcgggtacgtgcccttc
gccgcgaccttcgcatccttctccgcgttgctgtgtgccgagcagatccgcaccgattgc
gcgtatccgcggatgccggtccggatcgtcgggcaccactccggcatgtcgatggggttc
tacggcaccagccaccacgcactcgaggatctgggcgtgctgcgcactttcgccgagctc
acagtggtgtgcgcgaccgatgccaaccacctccgtgcgatcctgcgggcatcggtggat
caccctggtgcgatgtacatccggctcggccgcggccgcgacccgcaggtctattcgatg
gtgcccgacctcacgctcggcaagtccattcggctccgcgagggcagcgacctgaccatc
gtcgccaccggcaccgaggtgcacccgtcgctggaggcagcggagatcctggccggcgag
ggcgtgagtgtgcgggtggtcgacatgcacacggtggctccgctcgatgtcgacgaggtt
ctcgccgcggcccgcgagaccggcgccgttctcaccgtcgaggagcacaacgtgaccaac
ggcctcggcacggcggtcgccgaggcgctcctgctcggcggtgcgccgccggtgcggttc
gcgaaacacggtgtgcccgacgagtacatcccggtgggcccaccagcggcgctgtatgcg
aagtaccggctggacgcgcccgggatcgcggccgtagtcagggagatggtgcggtga

DBGET integrated database retrieval system