KEGG   Tsukamurella paurometabola: Tpau_3955Help
Entry
Tpau_3955         CDS       T01228                                 

Definition
(GenBank) Integrase catalytic region
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve rve_3 rve_2 HTH_29
Motif
Other DBs
NCBI-ProteinID: ADG80527
UniProt: D5UMQ3
Position
4075592..4076491
Genome map
AA seq 299 aa AA seqDB search
MYPLVKELADDGVPVTVSCRVLKLSRQPYYRWLAAPVPATELVEAYRANALFDASVDDPE
FGHRLLADEARAAGEPMADRTAWRICRDNRWWSVFGKKRSSKGGKPGPAVHDDLCTVTDE
HGRTRHRFTADAPNRLWLTDITEHRAREGKLYLCAIKDAYSGRIVGYSVDSRMKARLAVN
ALNNAVAMRGDVTGCIVHSDRGSQFRSRKFRRALEYHGLRGSMGRVASCGDNAAMESFFS
LLQNNVLDRHCWATRQELRTAIITWIERTYHRRRRQRRLGRLTPIAFESTMNPAAPHAA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtacccgctcgtgaaagagctcgccgacgacggtgttcccgtcacggtgtcgtgccgg
gttttgaagctctcccgtcagccttactaccgttggctcgccgccccggtccccgcgacg
gagctggtcgaggcgtatcgcgcgaacgccctgttcgacgccagcgttgatgatccggag
ttcggtcaccggttactcgcagacgaggcccgcgctgccggtgagcctatggcggaccgc
actgcgtggcggatctgccgcgacaaccggtggtggagcgtcttcggaaagaaacgctcg
agcaagggcggcaaacccgggcccgcggtccacgacgatctatgcaccgtcaccgacgag
cacggcaggactcgtcaccggttcaccgcagatgcaccgaatcggttgtggctcacagat
atcactgaacacagggctcgggaagggaagctgtatctgtgtgcgatcaaagatgcctac
tccgggcggatcgtcggctactccgtcgactcgaggatgaaggcccggctcgccgtcaac
gccctcaacaacgctgtcgcgatgcgcggtgatgtcaccggatgcatagttcatagtgac
agaggatcgcaattccggagccgaaaattccgacgtgccttggaatatcacggactacgc
ggatcaatgggccgagtcgcctcctgcggcgacaatgccgcgatggagtcgttcttcagc
ctgctgcagaacaacgtcctcgaccgccactgctgggccacccggcaggaactgcggacc
gcgatcatcacctggatcgaacggacctaccaccgccggcgccgacaacgccgccttgga
cgattgacacccatcgcattcgagtccaccatgaacccggccgcgccacacgcggcctga

DBGET integrated database retrieval system