KEGG   Tsukamurella paurometabola: Tpau_3957Help
Entry
Tpau_3957         CDS       T01228                                 

Definition
(GenBank) transposase IS3/IS911 family protein
Organism
tpr  Tsukamurella paurometabola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_Tnp_1 HTH_23 HTH_28 Wtap HAP1_N HTH_Tnp_4 DUF2046 HTH_10 Phage_terminase
Motif
Other DBs
NCBI-ProteinID: ADG80528
UniProt: D5UMQ2
Position
4076968..4077261
Genome map
AA seq 97 aa AA seqDB search
MPKPYPKEFRDDVVRVARNREPGVRLKQIAADFGISESCLMNWVKTADVEAGSKSGSSAA
QSATERQMRKRIRLLEQENEVLRRAAAYLSQANLPGK
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
gtgcctaagccgtatccgaaggagttccgcgacgatgtggtccgtgtcgcgcgtaatcgt
gagccgggagtccgtctcaagcagatcgctgccgacttcggcattagcgagtcgtgcctg
atgaactgggtgaagaccgccgatgtcgaggccggctccaagtccgggagcagtgcggcg
cagtcggcgaccgagaggcaaatgcgtaagcggattcggctccttgagcaggagaatgag
gtcctgcgtcgtgcggctgcgtatctgtcgcaggcgaacctgccgggaaaatga

DBGET integrated database retrieval system