KEGG   Salipiger profundus: Ga0080559_TMP1178Help
Entry
Ga0080559_TMP1178 CDS       T04656                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tpro  Salipiger profundus
Pathway
tpro00450  Selenocompound metabolism
tpro00970  Aminoacyl-tRNA biosynthesis
tpro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Ga0080559_TMP1178
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ga0080559_TMP1178
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tpro01007]
    Ga0080559_TMP1178
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tpro03016]
    Ga0080559_TMP1178
Enzymes [BR:tpro01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Ga0080559_TMP1178
Amino acid related enzymes [BR:tpro01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Ga0080559_TMP1178
Transfer RNA biogenesis [BR:tpro03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Ga0080559_TMP1178
 Prokaryotic type
   Other AARSs
    Ga0080559_TMP1178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-ProteinID: APX21974
UniProt: A0A1U7D1E5
Position
658098..659810
Genome map
AA seq 570 aa AA seqDB search
MARHLITSAIPYINGIKHLGNLVGSQLPADLFARYQRARGNEVLFLCATDEHGTPAELAA
AKAGKPVAEYCAEMHEVQARIAEGFRLSFDHFGRSSSPQNHRLTQHFAGVLAERGLIREV
SETQMYSPTDGRYLPDRYIEGTCPNCGFEDARGDQCDNCTKQLDPVDLINPHSVISGATD
LEMRETKHLYLCQSLIKDEIEAWIDSKTDWPVLTTSIAKKWLDDGDGLQDRGITRDLDWG
IPVKKGEEDWPGMEGKVFYVWFDAPIEYIACAQEWVDAGKGDDWSRWWRTDKGADDVTYT
QFMGKDNVPFHTLTFPATILGSGEPWKLVDYIKSFNYLNYDGGQFSTSRGRGVFMDQALE
ILPADYWRWWLLSHAPESSDAEFTWENFQSSVNKDLADVLGNFASRVTKFCRSKFGEVVP
EGGAYGDLETALIENLTAKIREYEEHMAHAEVRKAASALRAAWVLGNEYLQEAAPWSTFK
TDPETAAMQIRLALNLIRLYAVISAPFIPDASAQLLTALATQDDSWPDDVPAALQILPAG
HAFTVPDVTFRKITDTEREEWQARFAGKRD
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggcacggcacctcatcacctcggcgattccctacatcaacgggatcaagcacctcggc
aacctcgtgggcagccagctgcccgccgacctcttcgcccgctaccagcgcgcgcgcggc
aacgaggtgctgttcctctgcgcgaccgacgagcacggcaccccggccgagctcgccgcc
gccaaggccggcaagccggtcgccgagtactgcgccgagatgcacgaggttcaggcgagg
atcgccgagggcttccgcctcagcttcgatcacttcggccgctcctcgagccctcagaac
cacaggctcacccagcatttcgccggcgtgctggccgagcgcggcctgatccgcgaggtc
tccgagacgcagatgtactcgcccaccgacgggcgctacctgccggaccgctacatcgag
ggcacctgcccgaactgcggcttcgaggatgcgcgcggcgaccagtgcgacaactgcacc
aagcagctcgacccggtcgatctcatcaacccgcactcggtgatctcgggcgccaccgac
ctcgagatgcgcgagaccaagcacctctacctgtgccagagcctgatcaaggacgagatc
gaggcctggatcgacagcaagaccgactggccggtgctgaccacctcgatcgccaagaaa
tggctggacgacggcgacggcctgcaggatcgcggcatcacccgcgatctcgactggggc
atcccggtgaagaagggcgaagaggactggcccggcatggaaggcaaggtcttctacgtc
tggttcgacgcaccgatcgaatacatcgcctgcgcgcaggaatgggtcgatgccggcaag
ggcgacgactggtcccgctggtggcgcaccgacaagggcgcggacgacgtgacctacacg
cagttcatgggcaaggacaacgtgcccttccacacgctcaccttcccggcgacgatcctc
ggctccggcgagccatggaagctggtcgactacatcaagtcgttcaactacctcaactac
gacggcggccagttctcgacctcgcgcggacgcggcgtcttcatggaccaggcgctggag
atcctccccgccgactactggcgctggtggctgctgagccacgcaccggaaagctcggac
gcggaattcacctgggagaacttccagtcctccgtgaacaaggatctcgccgacgtgctg
ggcaacttcgccagccgcgtcaccaagttctgccgctcgaaattcggcgaggtcgtcccc
gagggcggtgcctacggcgatctcgaaaccgccctgatcgagaacctcaccgcgaagatc
cgcgagtacgaggaacacatggcccacgccgaggtccgcaaggccgcgagcgccctgcgc
gcggcctgggtgctcggcaacgaatacctgcaggaggcggccccctggtcgaccttcaag
accgaccccgaaacggcggcgatgcagatccgtctcgcgctgaacctgatccggctctac
gcggtgatctccgcgccgttcatcccggacgcctcggcgcagctgctgaccgcgctcgcc
acccaagacgacagctggcccgacgacgtgccggcggcgctgcagatcctgcccgcaggt
cacgccttcaccgtgcccgacgtgaccttccgcaagatcaccgacaccgaacgcgaggaa
tggcaggcgcggttcgccggcaagcgtgactga

DBGET integrated database retrieval system