KEGG   Salipiger profundus: Ga0080559_TMP2528Help
Entry
Ga0080559_TMP2528 CDS       T04656                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
tpro  Salipiger profundus
Pathway
tpro03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tpro00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Ga0080559_TMP2528
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tpro03011]
    Ga0080559_TMP2528
Ribosome [BR:tpro03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Ga0080559_TMP2528
  Bacteria
    Ga0080559_TMP2528
  Archaea
    Ga0080559_TMP2528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: APX23324
UniProt: A0A1U7D577
Position
2052075..2052455
Genome map
AA seq 126 aa AA seqDB search
MGKDKNPRRVADNEAMAKLRMLRTSPQKLNLVAALIRGKKVEKALTDLTFSKKRIAVDVK
KCLQSAIANAENNHGLDVDELVVAEAYVGKNLVMKRGRPRARGRFGRINKPFSEITIKVR
QIEEQA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggataagaatccccgccgcgtggcggacaacgaggcgatggcaaagctccgc
atgctgcgtacgtcgccgcagaagctgaacctggtggccgcgctgatccgtggcaagaag
gtcgaaaaggcccttacggacctgaccttctcgaaaaagcggatcgccgtggacgtgaag
aagtgccttcagtccgccattgcgaatgccgagaacaaccacggtcttgacgtcgacgag
ctcgtcgtcgccgaggcgtacgtgggcaagaaccttgtgatgaagcgtggccgtccccgg
gcacgtggtcgcttcggccgcatcaacaagccgttctcggaaatcaccatcaaggtgcgc
cagatcgaggagcaagcctaa

DBGET integrated database retrieval system