KEGG   Salipiger profundus: Ga0080559_TMP2586Help
Entry
Ga0080559_TMP2586 CDS       T04656                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
tpro  Salipiger profundus
Pathway
tpro00260  Glycine, serine and threonine metabolism
tpro01100  Metabolic pathways
tpro01110  Biosynthesis of secondary metabolites
tpro01120  Microbial metabolism in diverse environments
tpro01130  Biosynthesis of antibiotics
tpro01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ga0080559_TMP2586
Enzymes [BR:tpro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Ga0080559_TMP2586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: APX23382
UniProt: A0A1U7D5J1
Position
complement(2107652..2108698)
Genome map
AA seq 348 aa AA seqDB search
MFFASDNSGPVPPQVLEALARANDGHVAGYGDDALTRDVTERLRALFEAPEAAVYLVPTG
TAANVLALATLCPPYATVFCSPVAHIHEDECNAPEFFTGGAKLTLVGNSDRMTPDALRAA
IEAEESRGVHGPERGPVSITQLTERGNVYSLDEIRALADVAHDYGLPVHLDGARFANAAV
KLGATPAEMSWKAGVDVCVFGGTKNGLMGVEAVLIFDPEKARGFERRRKRGALLFSKHRY
LAAQMDAYLQDDLWRDLAERANARCDQLVQGLKGLGLTVANDRHANIVFFEMSRAAHRKV
QAAGAVYSLWGAAEGPDDAPALARLVCDWSVTPEAVTAFLDTVADAIA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgttctttgcctccgacaattccggcccggtcccgccgcaggtgctcgaggcgctcgcc
cgtgccaacgacggccacgtcgcgggctacggcgacgacgccctgacccgggatgtcacc
gaacgcctgcgcgccctcttcgaggcccccgaggcggcggtctacctcgtgcccacgggc
accgccgcgaacgtgctggcgctcgccacgctttgcccgccctatgccacggtgttctgc
tcgccggtcgcgcatatccacgaagacgagtgcaacgcgcccgagttcttcaccggtggc
gccaagctgaccctcgtcggcaacagcgaccgcatgacccccgacgccctgcgcgccgcc
atcgaggccgaggaaagccgcggcgtgcacggccccgagcgcgggcccgtctcgatcacc
cagctcaccgagcgcggcaacgtctactcgctcgacgagatccgcgcgctggcggacgtg
gcacatgactacggcctgccggtgcacctcgacggcgcccgcttcgccaacgccgccgtg
aagctcggcgccaccccggccgagatgagctggaaggccggcgtcgacgtctgcgtcttc
ggcggcaccaagaacggcctgatgggtgtcgaggcggtgctgatcttcgacccggagaag
gcgcgcggcttcgagcgtcgccgcaagcgcggcgccctgctcttctccaagcaccgctat
ctcgcggcccagatggacgcctacctgcaggacgatctctggcgcgatctggccgaacgg
gccaatgcgcgctgcgatcaactcgtgcaggggctcaagggcttgggcctgaccgtcgcc
aacgaccgtcacgccaacatcgtgttcttcgagatgtcccgcgccgcccaccgcaaggtg
caggccgccggcgccgtctacagcctctggggcgccgccgagggccccgacgacgcacct
gcgctggcccggctcgtctgcgactggtcggtcacccccgaggccgtcacggctttcctc
gacaccgtggccgacgcgatcgcctga

DBGET integrated database retrieval system