KEGG   Salipiger profundus: Ga0080559_TMP3179Help
Entry
Ga0080559_TMP3179 CDS       T04656                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tpro  Salipiger profundus
Pathway
tpro00071  Fatty acid degradation
tpro00072  Synthesis and degradation of ketone bodies
tpro00280  Valine, leucine and isoleucine degradation
tpro00310  Lysine degradation
tpro00362  Benzoate degradation
tpro00380  Tryptophan metabolism
tpro00620  Pyruvate metabolism
tpro00630  Glyoxylate and dicarboxylate metabolism
tpro00640  Propanoate metabolism
tpro00650  Butanoate metabolism
tpro00900  Terpenoid backbone biosynthesis
tpro01100  Metabolic pathways
tpro01110  Biosynthesis of secondary metabolites
tpro01120  Microbial metabolism in diverse environments
tpro01130  Biosynthesis of antibiotics
tpro01200  Carbon metabolism
tpro01212  Fatty acid metabolism
tpro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tpro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ga0080559_TMP3179
   00630 Glyoxylate and dicarboxylate metabolism
    Ga0080559_TMP3179
   00640 Propanoate metabolism
    Ga0080559_TMP3179
   00650 Butanoate metabolism
    Ga0080559_TMP3179
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Ga0080559_TMP3179
   00072 Synthesis and degradation of ketone bodies
    Ga0080559_TMP3179
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ga0080559_TMP3179
   00310 Lysine degradation
    Ga0080559_TMP3179
   00380 Tryptophan metabolism
    Ga0080559_TMP3179
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ga0080559_TMP3179
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ga0080559_TMP3179
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ga0080559_TMP3179
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tpro04147]
    Ga0080559_TMP3179
Enzymes [BR:tpro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Ga0080559_TMP3179
Exosome [BR:tpro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ga0080559_TMP3179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APX23975
UniProt: A0A1U7D7C8
Position
complement(2746642..2747814)
Genome map
AA seq 390 aa AA seqDB search
MTDVVITGAARSAMGGFQGMFSDLTAADLGGAAIRAARTEAGDPVVDELLMGCVLPAGQG
QAPARQAGFAAGLGEAVPATTLNKMCGSGMKAAMMAFDQLALGHAGTIIAGGMESMTNAP
YLLPAMRDGARIGHKQVIDHMFLDGLEDAYDKGRLMGTFAEDCAEAFQFTRDAQDQYAIA
SLDNALDAERSGAFAREITPVTVHARTGEEVITRDEQPARARPEKIPHLKPAFRKDGTVT
AANSSSISDGAAALVMTTLDEVERSGATPRARVLGHASHAQAPNLFPTAPIPAAQKLLDR
IGWKKSDVDLWEVNEAFAVVPMAFMREMGLPRDIVNVNGGACALGHPIGASGARIIVTLL
NALETRGLKRGVAAICIGGGEGTAIAIERM
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgtggtgatcaccggcgccgcccgcagcgccatggggggctttcaggggatg
ttctcggacctgaccgccgccgacctcggcggggcggcgatccgcgcggcgcggaccgag
gccggtgaccccgtggtcgacgagcttctgatgggctgcgtcctgccggcgggccagggc
caggcgccggcgcggcaggcgggcttcgccgccggcctcggcgaggcggtcccggcaacg
accctcaacaagatgtgcggctcggggatgaaagccgcgatgatggcgttcgaccagctg
gcactcggtcatgccggaacgatcatcgccggtggcatggagagcatgaccaatgcgccc
tacctgctgcccgcgatgcgagacggcgcccggatcggccacaagcaggtgatcgaccac
atgttcctggacgggctcgaagatgcctacgacaaggggcggctgatgggcaccttcgcc
gaggattgcgccgaggccttccagttcacccgcgacgcgcaggatcaatacgccatcgcc
tcgctcgacaatgccctcgacgccgagcgctcgggcgccttcgcgcgcgagatcacgccc
gtcacggtgcacgcccgcaccggcgaagaggtcatcacccgcgacgagcagcccgcccgc
gcacggcccgagaagatcccccacctcaagcccgccttccgcaaggacgggacggtgacc
gccgcgaactcctcgtcgatttccgacggcgcggcggcgctggtaatgacgacgctcgat
gaggtcgagcgcagcggtgccacgccccgcgcccgggtgctcggccatgcaagccacgcg
caggcgccgaacctctttcccaccgcgccgatccccgccgcgcagaagctgctcgaccgc
atcggctggaagaagtccgacgtcgatctctgggaggtcaacgaggccttcgccgtggtg
cccatggccttcatgcgcgagatggggctgccgcgcgacatcgtgaacgtgaacggcggc
gcctgcgcactcggccacccgatcggcgccagcggcgcgcggatcatcgtcaccctgctg
aacgccctcgagacgcgcggcctgaagcgcggcgtcgcggcgatctgcatcggtggcggc
gagggcacggccatcgccatcgagcgcatgtag

DBGET integrated database retrieval system