KEGG   Salipiger profundus: Ga0080559_TMP361Help
Entry
Ga0080559_TMP361  CDS       T04656                                 

Definition
(GenBank) NADP-dependent aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
tpro  Salipiger profundus
Pathway
tpro00040  Pentose and glucuronate interconversions
tpro00053  Ascorbate and aldarate metabolism
tpro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ga0080559_TMP361
   00053 Ascorbate and aldarate metabolism
    Ga0080559_TMP361
Enzymes [BR:tpro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     Ga0080559_TMP361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: APX25844
UniProt: A0A1U7DCF6
Position
pTPRO1:complement(103589..105115)
Genome map
AA seq 508 aa AA seqDB search
MLDKSSFTPHGKHLVAGDWVAGEATFSSEPAHGPAHEYSVGTPALVDRAVEAAEAAFETY
GYLGREARARFLDTIADEIEARGAQITEIGTQESGLPEARLNGERGRTCGQLRMFAEHIR
KGDYLDRRHDKALPDREPLPRPDLKMVQRPIGPVAVFGASNFPLAFSTAGGDTASALAAG
CPVVVKGHSAHPGTGEIVAEAIHAAIVKCDMPAGVFSLIQGGKRDVGQALVQHPLIKAVG
FTGSLGGGRALFDLCAQRDEPIPFFGELGSVNPMFLLPEAVKARGAEIGTAWAGSLTMGA
GQFCTNPGIAVVGTGPEGDAFVKAAAEGLADVSPQCMLTQGIADAYTSGKSRFDGRNAVK
PVMTAESEGRNAAPNLYETDAASYLQDHALGEEVFGPLGLVVRVEDPDDMERLARGFEGQ
LTVTLHMDEGDTAQAQRLMPVLERKAGRILVNGFPTGVEVCDSMVHGGPFPASTNFGATS
VGTLAIRRFLRPVCYQNMPDALLPEDLQ
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaagtccagcttcacccctcacggcaagcacctggttgccggcgactgggtc
gccggcgaggcgaccttttcctcggagcccgcgcatgggccggcgcatgagtattccgtc
ggcacgccggcgctggtcgaccgcgcggtggaagccgccgaggcggccttcgagacctac
ggctacctgggccgcgaggcgcgggcgcgcttcctcgacaccatcgccgacgagatcgag
gcgcgcggcgcccagatcaccgagatcggcacccaggaaagcggcctgcccgaggcgcgg
ctcaacggcgagcgcggccgcacctgcggccagctgcgcatgttcgccgagcacatccgc
aagggcgactacctcgaccgccgccacgacaaggcgctgcccgaccgcgagccgctgccg
cgcccggacctgaagatggtccagcgcccgatcggcccggtggcggtcttcggcgcctcg
aacttcccgctcgccttctcgaccgccggcggcgacaccgcctcggcgctggcggcgggc
tgcccggtggtggtcaagggccactcggcccaccccggcaccggcgagatcgtggccgag
gccattcacgcggccatcgtcaaatgcgacatgccggcgggggtcttctcgctcatccag
ggcggcaagcgcgacgtcggccaggcgctggtgcagcacccgctgatcaaggccgtgggc
ttcaccggcagcctcggcggcgggcgcgcgctgttcgacctctgcgcacagcgcgacgag
ccgatccccttcttcggcgagctgggctcggtcaacccgatgttcctccttcccgaggcc
gtgaaggcccgtggcgccgagatcggcacggcctgggcgggctcgctgaccatgggcgcg
gggcagttctgcaccaatcccggcatcgcggtggtgggcaccggccccgagggcgacgcc
ttcgtcaaggcggcggccgaggggctggcggatgtgagcccgcaatgcatgctgacgcaa
ggtatcgccgatgcgtatacaagcggtaaatcccgcttcgacggtcgcaacgcggtgaag
ccggtgatgaccgccgagagcgagggccgcaacgccgcgcccaacctctacgagaccgac
gcggcgagctacctgcaggatcacgcgctcggcgaggaggtcttcggaccgctggggctc
gtggtgcgggtcgaggaccccgacgacatggagcgcctggcgcgcggcttcgagggccag
ctgaccgtgacgctgcacatggacgagggcgacacggcgcaggcgcagcggctgatgccg
gtgctcgagcgcaaggccggccggatcctcgtcaacggcttccccaccggcgtcgaggtc
tgcgacagcatggtccacggcgggccgttcccggcctcgaccaacttcggcgccacttcg
gtcggcacgctggccatccgccgcttcctgcgcccggtctgctaccagaacatgcccgac
gcgctgctccccgaagacctgcaataa

DBGET integrated database retrieval system