KEGG   Salipiger profundus: Ga0080559_TMP388Help
Entry
Ga0080559_TMP388  CDS       T04656                                 

Definition
(GenBank) esterase/lipase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
tpro  Salipiger profundus
Pathway
tpro00903  Limonene and pinene degradation
tpro00930  Caprolactam degradation
tpro01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tpro00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Ga0080559_TMP388
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Ga0080559_TMP388
Enzymes [BR:tpro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     Ga0080559_TMP388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Abhydrolase_6 Hydrolase_4 Thioesterase COesterase
Motif
Other DBs
NCBI-ProteinID: APX25871
UniProt: A0A1U7DCI2
Position
pTPRO1:132792..133622
Genome map
AA seq 276 aa AA seqDB search
MTTRPDTEADLRGLIRDTAMDGDIPERRDGFRRIASGQPEAMAERVERGGVSALAVGEGP
ELVWFHGGGYVFGAPETHLVLATALARQGLRVLLPRYRLAPEAPWPAMLEDARAFVAASG
PVVLGGDSAGGHLALAVARRTRVEGLALASPNTDRTGQSSTRGRDGDLMNDDATDAELAR
MAMPGMPPDDPDVSPLVADLSGLPPLHLEAAGAEILLDDSLLLARAAALAGVDVRLRVTP
GQFHMFQLWPDVLPRGDESLARLGAFARDALARDTR
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacgccccgacaccgaagcagacctgcgcgggctgatccgcgacaccgcgatg
gacggcgacattcccgagcgccgggacgggttccggcgcatcgcttccgggcagcccgag
gcgatggccgagcgcgtcgagcgcggcggcgtgtcggcgctcgcggtgggggaggggccc
gagctcgtctggttccacggcggcggctacgtcttcggcgctcccgagacgcacctggtg
ctcgccaccgcgctcgcgcggcagggcctgcgcgtcctgctgccgcgctaccgtctggcc
cccgaggcgccctggccggcgatgctcgaggatgcgcgcgccttcgtcgcggcaagcggc
ccggttgtgctggggggcgacagcgcgggcggccacctcgcgctggcggtggcgcggcgg
acccgggtggaggggctggcgctggcctcgcccaacaccgaccgcaccgggcagagcagc
acgcgcgggcgcgacggtgacctgatgaacgacgacgcgaccgacgccgagctcgcgcgc
atggcgatgcccggcatgccgcccgacgacccggacgtctcgccgctggtcgcggacctc
tcggggctgccgccgctgcacctcgaggcggcgggcgccgagatcttgctcgacgacagc
ctgctgctggcccgggccgcggcgctcgccggggtcgacgtgcggctgcgcgtcaccccg
gggcagttccacatgttccagctctggcccgacgtgctgccgcgcggagacgaatccctc
gcgcggctgggggccttcgcacgcgatgcactggcgcgcgacacgcgctga

DBGET integrated database retrieval system