KEGG   Salipiger profundus: Ga0080559_TMP399Help
Entry
Ga0080559_TMP399  CDS       T04656                                 

Definition
(GenBank) (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
tpro  Salipiger profundus
Pathway
tpro00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:tpro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Ga0080559_TMP399
Enzymes [BR:tpro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Ga0080559_TMP399
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Ga0080559_TMP399
    1.1.1.-  
     Ga0080559_TMP399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc Pyr_redox NTP_transf_3 TrkA_N Pyr_redox_2 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: APX25882
UniProt: A0A1U7DCP3
Position
pTPRO1:145134..146189
Genome map
AA seq 351 aa AA seqDB search
MKAARWHGAKDIRVEDIDAPTPGAGEIRIKVAWTGICGSDLHEYLAGPIFVPVGDAHPLS
HDKAPITMGHEFSGVVTELGEGVTDLAVGDRVAIEPIFSCDDCAACRAGLYNLCDKLGFV
GLSGGHGGFAAYSVVPARMAHKIPDELSIDQGALVEPAAVAVHAVRISQINVGDKAAVFG
AGPIGLLVVEALRAAGASEIHVVEPSETRRAKALDLGATSAIDPGDTDPVQAILAATGIG
VDVAFEVTGVAPVLPQAIDSTRYEGQTLVVSIWEGEASFQPNTVVLRERQIKGTIAYRHI
YPAVMELMRQGYFAAEKLVTKRIALDDIVAEGFETLVAEKSQIKILVEAPD
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcagcacgctggcatggcgcaaaagacatccgcgtcgaggacatcgacgccccc
acccccggcgcaggagagatcaggatcaaggtggcctggaccggcatctgcggcagcgac
ctgcacgagtatcttgcggggccgatcttcgtgccggtgggcgacgcccacccgctgagc
cacgacaaggcgccgatcaccatggggcacgaattcagcggtgtcgtcaccgagctgggc
gagggcgtgaccgacctggccgtgggtgaccgagtcgcgatcgagccgatcttttcctgc
gacgactgtgccgcctgccgggcggggctctacaacctctgcgacaagctcggtttcgtc
ggcctctcgggcggccacgggggctttgccgcctactcggtggttccggcgcggatggcg
cacaagatccccgacgagctgtcgatcgaccagggggcgctcgtcgagcctgccgccgtc
gccgttcacgcggtgcggatcagccagatcaacgtcggcgacaaggccgcggtcttcggg
gccggccccatcgggcttctggtggtcgaggcgctgagggcggccggagcctccgagatc
cacgtggtcgagccctccgagacccgccgcgccaaggcgctggatctcggcgcgaccagc
gccatcgaccccggcgacacggacccggtgcaggcgatcctcgcggccaccggcatcggc
gtcgacgtggccttcgaagtgaccggcgtcgcgccggtgctgccgcaggccatcgattcc
acccgctacgaggggcagaccctcgtcgtgtcgatctgggaaggcgaggcctcgttccaa
cccaacacggtcgtgctgcgcgagcgccagatcaaggggaccatcgcctatcgccacatc
tacccggcggtcatggaactgatgcgtcagggttacttcgccgccgagaagctggtgacc
aagcgcatcgcgctcgacgacatcgtggccgagggattcgagacgctggtggccgagaaa
tcgcagataaagatcctggtcgaggcgccggactga

DBGET integrated database retrieval system