KEGG   Salipiger profundus: Ga0080559_TMP4263Help
Entry
Ga0080559_TMP4263 CDS       T04656                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
tpro  Salipiger profundus
Pathway
tpro00030  Pentose phosphate pathway
tpro00480  Glutathione metabolism
tpro01100  Metabolic pathways
tpro01110  Biosynthesis of secondary metabolites
tpro01120  Microbial metabolism in diverse environments
tpro01130  Biosynthesis of antibiotics
tpro01200  Carbon metabolism
Module
tpro_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
tpro_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
tpro_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:tpro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ga0080559_TMP4263
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Ga0080559_TMP4263
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tpro04147]
    Ga0080559_TMP4263
Enzymes [BR:tpro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Ga0080559_TMP4263
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Ga0080559_TMP4263
Exosome [BR:tpro04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Ga0080559_TMP4263
  Exosomal proteins of colorectal cancer cells
   Ga0080559_TMP4263
  Exosomal proteins of bladder cancer cells
   Ga0080559_TMP4263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N Nrap_D5
Motif
Other DBs
NCBI-ProteinID: APX25059
UniProt: A0A1U7DA96
Position
complement(3884509..3885996)
Genome map
AA seq 495 aa AA seqDB search
MNRIGVTPEMVSRVIPVDPFDLVIFGGTGDLARRKILPALFRRFCAGQMPDDSRIIGAAR
SEMSESEYRDLVRDALAEFGKKHAEDKHAVEAFLKHLHYVAVDAMGDGGWKEMKALLRDE
EGLVRAFYFSVGPSLFGPLAEQLRENGLADRETRIVVEKPFGHDLESARSLNEELAQHFY
EDQIYRIDHYLGKETVQNLMAVRFGNMLFEPLWNAQYVDHIQITVAETVGVGGRGSYYDH
SGAMRDMVQNHLMQLLCLIAMEPPAQFEADAVRDEKLKVIRALDPVDPDQIVRGQYTSDG
SMPSYREDAENPTSKTESFIALKCYISNWRWANTPFYLRTGKRLSARASEIAVVFKETPH
SIFGIDSGRHRNVLSIRLQPDEGMTLGVTIKEPGPGGMRLVDVPLDMSFADALGPDAEEV
TDAYERLIMDVIRGNQTLFMRGDEVEAAWAWTDPLIEGWERRGDSPKPYDAGSGGPDDAA
FLINRDGRRWRGIKI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaatcggagttacgccagagatggtatcccgcgtcattcccgtcgatccgttt
gatcttgtcattttcggggggaccggcgacctggcccgccgcaagatcctccccgcgctg
ttccggcgcttttgcgcgggccagatgcccgacgacagccgcatcatcggtgcggcccgc
tccgagatgtccgagagcgagtatcgcgatctcgtccgtgatgcgctggccgagttcggc
aagaagcacgccgaggacaagcacgccgtcgaggcgttcctgaagcatctccactatgtc
gccgtcgacgccatgggtgatggcggctggaaggagatgaaggcgctgctgcgcgacgag
gaggggcttgtgcgggccttctacttctcggtggggccgagcctcttcgggccgctcgcc
gagcagctgcgcgagaacgggctggccgatcgcgagacccggatcgtcgtcgagaagccc
ttcggccacgatctggaaagcgcgcgctcgctgaacgaggaactggcacagcacttctac
gaggaccagatctaccggatcgaccactacctcgggaaggagacggtgcagaacctcatg
gcggtccgcttcggcaacatgctgttcgagccgctctggaacgcgcaatacgtcgaccac
atccagatcaccgtggccgagaccgtgggcgtcggcgggcggggctcctactacgaccat
tccggtgcgatgcgggacatggtgcagaaccacctgatgcagcttctctgcctgatcgcg
atggagccgccggcacagttcgaggccgacgcggtgcgcgacgagaagctcaaggtgatc
cgcgcgctcgacccggtcgaccccgaccagatcgtgcgtggccagtatacctcggacggc
tcgatgccctcctaccgcgaggatgccgagaacccgacctcgaagaccgagagcttcatc
gcgctcaagtgctacatctcgaactggcgttgggcgaacacgccgttctacctgcgcacc
ggcaagcgcctctcggcgcgcgcctcggagatcgcggtggtgttcaaggagacgccgcac
tcgatcttcggcatcgactcggggcgtcaccgcaacgtgctgtcgatccggctgcagccc
gacgagggcatgacgctgggcgtgaccatcaaggagccagggccgggtggcatgcggctg
gtcgacgtgccgctcgacatgtccttcgccgatgcgctgggaccggacgcggaagaggtg
acagacgcctacgaacgtctcatcatggacgtgatccgcggcaaccagacgctcttcatg
cggggcgacgaggtcgaggccgcatgggcctggaccgacccgctgatcgagggctgggaa
cgccgcggcgacagcccgaaaccttacgacgccggcagcggcggtccggatgatgcggcc
ttcctcatcaaccgcgacggtcgccgctggagagggatcaagatatga

DBGET integrated database retrieval system