KEGG   Thalassiosira pseudonana: THAPSDRAFT_2186
Entry
THAPSDRAFT_2186   CDS       T01078                                 

Definition
(RefSeq) predicted protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tps  Thalassiosira pseudonana
Pathway
tps00100  Steroid biosynthesis
tps01100  Metabolic pathways
tps01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    THAPSDRAFT_2186
Enzymes [BR:tps01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     THAPSDRAFT_2186
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 Corona_7
Other DBs
NCBI-GeneID: 7448642
NCBI-ProteinID: XP_002287183
JGI: 2186
UniProt: B8BTM4
Position
2
AA seq 460 aa
MTKPKDSFDYEFGGPLGTLATMIFLPLITLLLTHWASVGRLEFDHILPSSCSSSIVLLPS
AINTFIHSSVLCPSCIDVTILQSCALVILLWFVFQVALERMLPCETVMGAPLPGGSGNRL
PYRINGHLAFWVTLLVLDVAWPRWVDVNDGKGGMASSVLVFGRAPLTWLYDHHPTLAFVT
ILWTLLLSTYLHLKSFGKGLLLAAGGNSGNPFYDFFMGRELNPRWGTFDWKEFCELRPGL
IGWMILNLAMMSKQYERLGYVTGSMILINSFQGLYVWDALYQERAILTTMDITTDGFGFM
LIFGDLAWVPFTYSLQSRYLVDHDPHLSWTTLAAIVGVNIIGYLIFRGANSQKDAFRRDP
NSAEVSHLTFLQTKRGTKLLTSGWWGMARKINYTGDWIMGLSWCMVCGFESIVPYYYAIY
FAILLVHRSIRDDHMCQEKYGDDWGKYKSIVPYRFIPGVF
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaccaagccaaaagacagcttcgactacgagttcggaggccccctcggcactctcgcc
accatgatcttcctccccctcatcaccctcctactcacccactgggcatccgtcggtaga
ctcgagtttgaccacattctcccctcgtcatgctcttcttctatcgtcctactaccatcg
gcaatcaatacatttatacattcatcggtattgtgcccgtcgtgtatcgacgtaaccatc
cttcaatcatgtgcgctagtcattcttctatggttcgtgtttcaagtggcactggaacga
atgctcccgtgcgaaaccgtcatgggggcacccctccccggtggatcaggcaaccgattg
ccatatcgtatcaatggccatttggcattttgggtgacattgttggtgctggatgtggca
tggcctcgttgggtggatgtcaacgatggaaagggggggatggcatcatctgtgttggtg
tttgggagagctccgttgacttggttgtatgatcatcatcctactttggcatttgtcact
atactgtggacgcttctactctcaacatatcttcatttgaagagctttggaaagggatta
ctactagcagcgggtggaaacagtggcaatccattttacgactttttcatgggaagggag
ctcaatccacgatggggaacgtttgattggaaagagttttgtgaattgcgtcctggtctt
atcggatggatgatattgaacttggcgatgatgtcaaagcaatatgaacgtttaggatat
gtgacggggtcgatgattctcatcaacagctttcaagggttgtatgtctgggatgctttg
tatcaagaacgtgcgattttgacaaccatggatataactacggatgggtttggcttcatg
ctgatatttggcgacttggcgtgggttccattcacctacagtttacaatctcgctacttg
gttgatcatgatcctcatttgtcgtggacaacgttggcggccatagttggagtcaacata
attggctatctcatctttcggggagcaaattcacaaaaggacgcattccgaagagatcca
aactcagctgaagtgtcgcatctcacattcttacaaacgaaacgaggaacaaagctgtta
acgagcggctggtggggtatggcacgcaagatcaactatacaggagattggattatgggt
ctatcatggtgcatggtgtgcggctttgagagcatcgttccgtattactacgctatatac
tttgctattctgctggtgcatcggtctattagagacgatcacatgtgtcaagagaagtat
ggcgacgattggggcaagtacaaatcgattgttccatacagattcatccctggcgtcttt
tag

DBGET integrated database retrieval system