KEGG   Thalassiosira pseudonana: THAPSDRAFT_262513Help
Entry
THAPSDRAFT_262513 CDS       T01078                                 

Gene name
RPA2_2
Definition
(RefSeq) replication protein A2
  KO
K10739  replication factor A2
Organism
tps  Thalassiosira pseudonana
Pathway
tps03030  DNA replication
tps03420  Nucleotide excision repair
tps03430  Mismatch repair
tps03440  Homologous recombination
Module
tps_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:tps00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    THAPSDRAFT_262513 (RPA2_2)
   03420 Nucleotide excision repair
    THAPSDRAFT_262513 (RPA2_2)
   03430 Mismatch repair
    THAPSDRAFT_262513 (RPA2_2)
   03440 Homologous recombination
    THAPSDRAFT_262513 (RPA2_2)
DNA replication proteins [BR:tps03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    THAPSDRAFT_262513 (RPA2_2)
DNA repair and recombination proteins [BR:tps03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     THAPSDRAFT_262513 (RPA2_2)
   MMR (mismatch exicision repair)
     THAPSDRAFT_262513 (RPA2_2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     THAPSDRAFT_262513 (RPA2_2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon PaaX
Motif
Other DBs
NCBI-GeneID: 7449647
NCBI-ProteinID: XP_002290252
JGI: 262513
UniProt: B8C2T4
Position
5
AA seq 288 aa AA seqDB search
LSSSLPKTPTGFDNEGGFGSQNTPSRGGSSDGKPRRDYDAQTLIPVTIKMILDAYATPGA
AGGSGDLQLKDERPIHMVKVVVAVRSHEERSTNLFLDIEDGTGFTQAKVWVNEGDECSGV
VQLRQNACKDHQYVRIIGQVREFDGTRQIVANDVRPVSSGDEITYHFLEVAHSYEKHMKR
QQQGGGMGIGGAMGYGIGNMASAPPQQGGLGISAQSGGNMGGGSALNDAVLAFIQGAGNN
NDSGVHVNEITAKVSANGFTESDVRTAINNLSNEGHIYSTIDENHYQY
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
ctctcttcctccctacccaaaacaccaacaggattcgacaacgaaggaggcttcggctcc
caaaacaccccctctcgcggaggctcctccgacggcaaacctcgccgcgactacgacgcc
cagacactcatcccggtcactatcaaaatgatcctcgatgcctatgccaccccgggtgct
gccggtggatcgggggacttgcaattgaaggacgagaggcccattcatatggtcaaggtt
gtagttgcggtgaggagtcatgaggagcggtccactaatttgtttttggatattgaggat
ggtacgggctttactcaggcgaaggtttgggtgaatgagggagatgaatgtagtggtgtg
gtgcagttgaggcagaatgcctgtaaggatcatcagtatgttcgtattattggacaggtg
agggagtttgatggtacgaggcaaattgtcgccaatgatgtcaggccggtgagttcggga
gatgaaatcacctatcatttcttggaggtggctcattcgtatgagaagcatatgaagagg
cagcagcagggcggagggatgggaattggaggtgccatgggatatgggattggtaatatg
gcaagtgctcctcctcagcaggggggtttgggaattagtgctcagtctggggggaatatg
ggtggggggagtgcacttaatgatgcggtgcttgccttcatccagggtgctggcaacaac
aacgattcgggtgtacacgtgaatgaaatcacagcgaaggtctcagccaatggctttacc
gagagtgacgttagaactgcaatcaacaacttatccaatgaggggcatatttactctaca
atcgatgaaaatcactatcagtat

DBGET integrated database retrieval system