KEGG   Thalassiosira pseudonana: THAPSDRAFT_262521
Entry
THAPSDRAFT_262521 CDS       T01078                                 

Definition
(RefSeq) WD40-repeat protein
  KO
K13111  WD40 repeat-containing protein SMU1
Organism
tps  Thalassiosira pseudonana
Brite
KEGG Orthology (KO) [BR:tps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tps03041]
    THAPSDRAFT_262521
Spliceosome [BR:tps03041]
 Complex B
  Other components
   Complex B specific factors
    THAPSDRAFT_262521
SSDB
Motif
Pfam: WD40 LisH_TPL ANAPC4_WD40 Ge1_WD40 Cytochrom_D1 LisH PQQ Nup160
Other DBs
NCBI-GeneID: 7450062
NCBI-ProteinID: XP_002290699
JGI: 262521
UniProt: B8C2V5
Position
5
AA seq 540 aa
MSESSTTDIPSADILRLILAHLTESGLHQTCAALREESGLGMAGLFATSKGRLVSSAEEG
RWGEALEILEGLDVERHRQSFLEDYRLHHDGKSSLDDVERRITSLSSLRTSSASNGASTA
LLLPVNYYGPSNQTQQKRRSQIAKLLKRLVPEVPMQRLASLLQQSVRWQCHTGVFPTIQR
LFQNNDDEDGKISSAIDNCAVERIPSRSTQTIRLGKNSYIESAIFLPDGRGLVTGSSDGF
IEIWGEPISEKGGTNINYENLRTSDLSYQRNDDLMMHDTAVLAMDVSNDGTLLGTTSSDG
TVCVWKIMDGKLLRKLERAHGGSGGGDKGAAVTCIQFSPDGSKILTGGHDSTAREFGLLA
SRMLKEFRGHRSYVNCCSYAASGNALVVVTASADGNVRVWDGKTAEPMREITPPIPTSNA
VSIHTVMHLHSPPQTMIVVPRTDRAYLMSYTGAVLRVFTRDDVQGTDFLAASVSPSNRWL
FVAADDGKCVAFDVNTGKECSGRSEKASDITGIIHHPFRGLIGGYSNSKGQKRGILTLWK
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgagcgaatcctccaccaccgacattccatcagcagacatcctccgcctcatcctcgcc
cacctcaccgaatctgggttgcatcaaacatgcgccgctcttcgcgaggagtccggcctc
ggaatggctggattattcgccacctccaaaggacgacttgtgtcctctgcggaggagggg
cgatggggggaagcgttggagattttggaggggttggatgtggaacggcatagacagtct
tttttggaggattataggttacatcatgatgggaagagcagcttggacgatgtggagcga
cgcatcacttccttgtcgtctctgcgaacatcatccgcttccaatggggcgagtacggct
cttctccttcccgtaaactattacggtccatctaaccagacgcaacaaaaacgaaggagt
cagattgccaagttgctgaaacggctggtaccagaggttcctatgcagaggttggcatca
ttacttcagcagagtgtacgttggcagtgtcacacgggagtgtttcccactatacaaaga
ctgtttcaaaacaacgatgatgaggatggaaagatatcatcggctatcgacaactgtgcc
gttgaacgcattccatcacgatccacacagacgatacgtttgggcaaaaatagttatatt
gaatcagcaattttcctgcctgatgggagaggattggtaactggatcgagtgatggcttc
attgagatttggggggagcctatcagtgagaagggcgggaccaacattaactatgaaaat
ctgcggacgtctgatttatcgtatcaacgcaatgatgacttgatgatgcatgatacggca
gtactggcaatggatgtatccaacgacggaacattgttgggtacaacttcctccgatggc
acagtttgcgtgtggaagattatggatggcaagctactacgaaagcttgagagggctcac
ggtggcagcgggggtggcgacaagggtgctgccgttacctgcattcagttctcgccggac
ggatcaaagattttgaccggaggacatgattccacagctcgtgaatttggcttgttggca
agtcggatgctcaaggaatttagaggacaccgatcgtacgtcaactgctgcagttacgcg
gcaagtggcaatgctctcgtcgttgtaacagcaagtgccgatggaaatgtgcgagtatgg
gatggcaagacggcagagccaatgagagagatcactccacccattcctacatctaatgct
gtaagtattcatacggtgatgcacttgcattcaccacctcagacaatgattgttgttccg
cggacagacagggcgtatctcatgtcgtatactggcgcagtgctgagagtgtttacacga
gatgacgtgcaaggtactgatttcctagcagcatcagtgagtccaagcaaccggtggctg
tttgtagctgcagatgacggaaagtgtgttgcatttgatgtgaatactggcaaagagtgc
agtgggaggagcgagaaggcatctgacatcaccggaatcattcatcatccttttcgcggt
ttgattggaggatacagcaatagcaaggggcagaagcgaggcatcttgactttgtggaag
tag

DBGET integrated database retrieval system