KEGG   Thalassiosira pseudonana: THAPSDRAFT_26365Help
Entry
THAPSDRAFT_26365  CDS       T01078                                 

Definition
(RefSeq) hypothetical protein
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
tps  Thalassiosira pseudonana
Pathway
tps00062  Fatty acid elongation
tps00071  Fatty acid degradation
tps00280  Valine, leucine and isoleucine degradation
tps00310  Lysine degradation
tps00380  Tryptophan metabolism
tps00410  beta-Alanine metabolism
tps00640  Propanoate metabolism
tps00650  Butanoate metabolism
tps01040  Biosynthesis of unsaturated fatty acids
tps01100  Metabolic pathways
tps01110  Biosynthesis of secondary metabolites
tps01130  Biosynthesis of antibiotics
tps01200  Carbon metabolism
tps01212  Fatty acid metabolism
Module
tps_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    THAPSDRAFT_26365
   00650 Butanoate metabolism
    THAPSDRAFT_26365
  Lipid metabolism
   00062 Fatty acid elongation
    THAPSDRAFT_26365
   00071 Fatty acid degradation
    THAPSDRAFT_26365
   01040 Biosynthesis of unsaturated fatty acids
    THAPSDRAFT_26365
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    THAPSDRAFT_26365
   00310 Lysine degradation
    THAPSDRAFT_26365
   00380 Tryptophan metabolism
    THAPSDRAFT_26365
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    THAPSDRAFT_26365
Enzymes [BR:tps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     THAPSDRAFT_26365
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     THAPSDRAFT_26365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2 NAD_binding_2 NAD_Gly3P_dh_N AlaDh_PNT_C LEM
Motif
Other DBs
NCBI-GeneID: 7446859
NCBI-ProteinID: XP_002292674
JGI: 26365
UniProt: B8C9J4
Position
10
AA seq 683 aa AA seqDB search
MWESDVHGNDSVKSIVFTSAKETGFIAGADIFDISQVEDKAQLVPVIEEALNFFLKMKSK
GVPMVAAIHGPALGGGLEWALWCDYRICTDSSSTKLGLPEVKLGLLPGFGGTQNLPKLVG
IQGGMDMMLTGKDIRPPKAKKMGLVDLVVAPQSLESVAIQSAEGLANGTVKKSKPKEKSL
MNRLIEDTPPGQYLMWDKVKKMVDKNTGGNYPAPYAIIDCVKYGLAHPSGNDKFKHEREE
FAKLAATKESEALIGIFDGMNQMKKLSSSAAPIDVKKVAVMGAGLMGAGIAQVTAEKGYD
VLLKDRDAASLGRGLSYMTENWEKKHKRKRMTTYQLNLNTSRVTPLADDTESWKRHFAGA
DLVIEAVFENLDLKRKIVQQVEEVTSDHCVFATNTSAIPIADIAAPGPDIKRPENIVGMH
YFSPVPSMPLLEIIPHAGTSDEALATAFAVGTKQGKTCVVVKDVPGFYVNRCLGPILVEV
SALVKEGVPLETLDKAMKKFGMPVGPITLIDEVGVDVAAKVSTFLSDADLGVRMGGGDLS
LMTNMVEKGWLGRKSNQGFYTYAGKKGKTIGSEVTAYLKEFTGGKVSNLSEKDIQDRIAS
RLVNEAAKCLEDDIIENPVAGDIGLVFGIGFAPFKGGPFRYLDAVGVSSYVDRMNGFADT
LGEQFEPCQLLKDYATSGKKFHG
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaatctgacgttcacggcaacgacagcgtgaaatccatcgtattcacttctgca
aaagagactggattcattgcaggtgctgacatctttgacatatctcaggtggaggataag
gcacagttggtccccgtgatcgaagaggcgttgaacttctttctcaagatgaagtctaaa
ggagttcccatggtggctgcaattcacggtccagccttgggaggagggttggagtgggct
ttgtggtgcgattatcgaatatgtacggattcttcatctactaaacttggattaccagag
gtgaagttgggattgctgcctggtttcggtggaacacagaatcttcccaagttggttggt
attcaaggaggaatggatatgatgctaactgggaaggacattcgtcctcctaaagcgaag
aagatgggacttgtggatttggtggtggctcctcaatctttggagagtgtggctattcag
tctgccgagggactagccaatggtacagtcaagaagagcaaaccgaaagagaagtctttg
atgaatcgtcttatcgaggatacgcctcccggtcaatatttgatgtgggataaggtgaag
aagatggtggataagaataccggagggaactatcctgctccatatgccattattgattgt
gtcaagtatggattagctcatccttcgggcaatgacaagttcaaacacgaacgtgaggag
tttgccaagcttgcagcaacgaaagagagcgaggcactcattggtatctttgacggtatg
aaccagatgaagaaactgtcgtccagtgctgctccaatcgacgtgaagaaggtggcagtc
atgggggctggattgatgggagcaggaattgctcaagtgactgccgaaaagggatacgat
gtcttgctcaaagatcgagatgccgcgagtcttggacgaggattatcgtacatgaccgaa
aattgggaaaagaaacacaagcgaaagagaatgacaacgtatcagttgaacttgaacaca
tctcgagttactcctcttgcggatgatacagagagttggaaacgtcattttgcaggtgcc
gacttggtgattgaggcagtgtttgagaacttggatttgaagagaaagattgtacagcag
gtggaggaagtgacttctgatcactgcgtctttgccaccaatactagtgctattccaatt
gcagacattgcggctcctgggcctgatatcaaacgccccgagaacattgttggtatgcat
tacttctctcccgtaccttccatgccattgctggagatcatccctcatgctggtacatcg
gacgaagctttggctactgcatttgctgtcggaacaaagcagggcaagacgtgtgtggtg
gtgaaggacgttcctggattttacgtcaatagatgtctcggtcctatccttgttgaagta
tctgcattggtgaaggagggagtaccacttgaaacactagacaaggcgatgaagaagttc
ggtatgcctgttgggccaatcactttgattgatgaggttggtgttgatgttgcggccaag
gtatcaaccttcctctcggatgccgatctcggagtaaggatgggtggaggcgacctatcg
ttgatgaccaacatggtagagaagggatggctcggaaggaagtctaaccagggcttctac
acctacgctggcaagaagggaaagacgattggatctgaagtgaccgcctacttgaaagag
ttcactggtgggaaggtgtctaacctcagcgagaaggatatccaagatcgcatcgccagt
cgcttggtaaatgaagctgccaagtgtttggaggatgacatcattgagaatcccgtagct
ggagacataggcctcgtattcggaattggattcgctcctttcaagggaggaccgttccga
tatcttgatgcagttggtgtctcttcgtacgtcgacagaatgaacggctttgcggatact
ctcggtgagcagtttgaaccgtgccagttgttgaaggattatgctacatctggaaagaag
tttcatggatga

DBGET integrated database retrieval system