KEGG   Thalassiosira pseudonana: THAPSDRAFT_268049Help
Entry
THAPSDRAFT_268049 CDS       T01078                                 

Gene name
ATH1
Definition
(RefSeq) ATP dependent RNA helicase
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
tps  Thalassiosira pseudonana
Pathway
tps03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:tps00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    THAPSDRAFT_268049 (ATH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tps03041]
    THAPSDRAFT_268049 (ATH1)
Enzymes [BR:tps01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     THAPSDRAFT_268049 (ATH1)
Spliceosome [BR:tps03041]
 Complex C
  Other components
   Step II factors
    THAPSDRAFT_268049 (ATH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD S1 AAA_19 AAA_30 T2SSE AAA_14 AAA_7 ABC_tran NB-ARC SRP54
Motif
Other DBs
NCBI-GeneID: 7445157
NCBI-ProteinID: XP_002286269
JGI: 268049
UniProt: B8BR58
Position
1
AA seq 1191 aa AA seqDB search
MAPPLPNADGTTTSTKKKKKNTEDEPPLTAVERLQSLNLVSRVASEWNNHLGISDRTLAE
FVINLAEKRIKSFLKDEFVKEDGSLYNVALTDGSSDKIRVALMDDKKKVKRAKSQKQQRG
DGLEVPLEQGFYEHDKDTNGDGDMSNVHQRSRNKRRWDDNDAKDGNGEPKDSGKRAMSNL
PAWMTQKSDEEKKSADVRETSQRSKSNLPAWMTKQQSGGAKDGLQLYQIFRGTVQRVLDF
GIVVDFNVPGNSEKASGMVHLTHVTKNRIEKPKDAGFRPGQSVYVKLISIGKRGASAGAG
EGGLMLSLKDVDQSSGKDLMPHRSAAAMGTGDYSSKSDTASNTAASASAAVEEEADNITQ
RQLQGLTEQELFEAQQLIRSGVLPVEQYPTFDNEGGLGMLAQETTEEQTEVELADFEPSF
LRGQTRRSGRDLEPIRIVKNPDGSLQRAAMQQGTLAKERRELRQAQANQLVDSIPKDLNR
PWEDPLPEAGERHFAQELRSINMSAFDGAPEWKQKAESKTLSYGIISNRSIKDQRESLPI
YRLKPELMRAMSENQVLVVIGETGSGKTTQMTQYMHELGITKNGMIGCTQPRRVAAVSVA
KRVSEEFGCTLGEEVGYSIRFDDATSKETIIKYMTDGMLMREYLADNDLKRYGALMLDEA
HERTIHTDVLFGLLKDLMRRRPDMKLIVTSATLDAEKFSSYFFECPIFTIPGRTFPVEIL
YTKEPESDYLDAALITIMQIHLSEPAGDILLFLTGQEEIDTACETLFSRMKALGDLAPEL
IILPVYSSLPSEMQSRIFEPAPPGTRKCIVATNIAEASLTIDGIYYVVDPGFSKQKAFNA
KLGMDSLVVTPISQASARQRAGRAGRTGPGKCYRLYTEMAYRNEMLPTNIPEIQRTNLGN
VVLQLKAMGINDLLGFDFMDPPPVATLVGAMEGLNALGALDDEGLLTRLGRKMAEFPLEP
NLSKMLLLSVDLGCSDEILTITSLLSVDNPFYRPRDKQGQADMKKAKFHQAEGDHLTLLA
VYKAWEASKFSNPWCFENFIQARSMKRAQDVRKQLVTIMDRYKLDILSSGKNYKKICMAI
TAGFFTNAAKKHPQEGYLTLVDQNPVYIHPSSAVFNKNPEWVIYHELVLTTKEYMRNVMV
IDAKWLIELAPSFYKKADPNKMTKSKRMEKIEPLFDRFNPKDSWRLSRRKG
NT seq 3576 nt NT seq  +upstreamnt  +downstreamnt
atggcaccacctctccccaacgccgacggcaccaccacctctaccaagaagaagaagaaa
aataccgaggatgaaccgcccctaaccgcagttgaacgtctccaatcactcaacctcgtc
tcccgcgtagcatccgaatggaacaaccacctaggcatatccgatcgtaccctcgccgag
tttgtcatcaacctggcagagaagaggattaaatccttcttaaaagatgagtttgtcaag
gaggatggatcactatacaacgtggctctaacggatggatcttctgataagattcgtgta
gctctcatggatgataagaagaaggtcaagagggccaagtcacagaaacagcagagaggt
gatggattggaagtgcctttggagcagggcttttacgagcacgataaggacacgaatggg
gatggagatatgagtaatgttcaccagaggtctagaaacaagaggcgttgggacgataat
gatgccaaagatggaaatggcgaaccaaaggactcgggaaagcgtgcaatgtctaatttg
cctgcgtggatgacgcaaaagtctgacgaagaaaagaagtcggccgacgtcagagagact
agtcagcgttccaaatctaatcttcctgcatggatgacgaagcaacaatcggggggagcc
aaagatggattgcaactgtatcaaatctttaggggaacggtacaacgtgtacttgatttt
ggtatcgttgttgatttcaacgttcctggtaacagtgaaaaggcttcgggcatggtgcat
ctcacacacgtgacaaagaatcgtattgaaaagccaaaagatgcaggttttcgtcctggg
cagtcagtgtatgtgaaacttatctccatcggtaaacggggcgcttcggcaggtgccgga
gaaggagggttgatgctaagtctcaaggatgtggaccagagttcggggaaggacctcatg
cctcatcgatctgctgcagcaatggggactggggactattctagcaaatccgatacagcg
agtaacactgcggcatcggcatctgcagctgttgaagaggaggcggataatatcacacaa
cgtcaattgcagggtttgacagagcaagaactgtttgaggcacagcagttgattcgatct
ggagtgttgcccgtggaacaatatccaacgtttgacaatgagggggggttgggaatgctt
gcacaggaaacgacagaagaacaaacggaggtggaattggctgactttgaaccatccttt
ttgcgtggtcagactcgtcgttcggggagggacttggagccgattcgtatagtaaagaat
cctgacggttctttgcagcgcgcggcgatgcaacagggaacgttggccaaagaacgtcgt
gagctgcgccaagcacaagccaatcagttggtagattctattcccaaagacctcaatcgt
ccgtgggaggacccacttcctgaggccggagaacgtcatttcgcacaggagctgcgtagt
atcaacatgagtgcctttgatggagcaccagagtggaaacaaaaggctgagagtaagacc
ttgtcgtacggtatcatctccaacaggtcaatcaaagatcagagggagagtttgccaatc
tacaggttgaagccggagttgatgcgtgcaatgtccgagaatcaggtgcttgtcgtgatt
ggtgaaacgggttccggaaagacgacccaaatgactcagtacatgcacgaactcggcatt
acaaagaatggaatgattggatgtacccagccgaggcgtgtcgccgcagtctcagtcgcc
aaacgtgtctcagaagagtttggatgtactctgggggaagaggttggttactccattcgt
tttgatgacgccacgtccaaggaaacaatcatcaagtacatgactgacggtatgctcatg
agggaatatctagctgacaatgacttgaagaggtatggggcactgatgttggatgaggca
cacgaacgcacaatccacacggatgttttgttcggattgttgaaggatctcatgcggcgt
aggccagacatgaagctcatcgtcacgtcggctacgttggacgctgaaaagttctctagc
tatttctttgaatgccctatctttacgattcctggaaggacgttccccgtcgaaatcctc
tacaccaaagagcccgaaagtgactaccttgatgcagcattgatcacgatcatgcagatc
cacctatcagaaccagctggagacattcttctcttcttgacgggccaggaggagattgat
acggcatgcgagacattgttcagccgtatgaaggcactcggagaccttgcacctgagctg
attatccttcccgtgtactcgtctcttccttccgagatgcaatcacgaatctttgaaccg
gctcctccgggaacacgaaagtgtattgttgctaccaacattgcagaggcttctcttact
attgacggtatctactatgtcgtggatcctggcttctcgaagcaaaaggccttcaatgca
aagctgggcatggactcacttgttgtcactccaatctcccaagccagtgctcgtcagagg
gctggtcgtgctggacgtaccgggccgggaaagtgttatcgactctatactgaaatggcg
tacaggaatgagatgcttccgaccaacatccccgagattcagcgaaccaacttgggtaat
gtcgttctgcaattgaaagcaatgggaatcaacgatttgttgggatttgactttatggat
ccacctccagtggccactcttgttggtgcaatggaagggctgaatgctcttggagcattg
gacgacgaaggattgctgactaggctcggacgcaagatggcagagtttcccttggaaccc
aatctctccaaaatgctgttgctctcggtggatttgggctgctctgacgagattcttaca
atcacttccttgctaagtgttgacaatcccttctatcgtcctcgtgataagcaagggcag
gctgatatgaagaaggcaaagttccaccaagcagaaggagatcacttgacgttgcttgct
gtgtacaaagcatgggaggcatccaagtttagcaacccttggtgctttgagaactttatc
caagcacgaagtatgaaacgtgcacaagacgtgaggaagcagcttgtaaccatcatggac
agatacaagctcgacattttgagttccggaaagaactacaagaagatttgcatggcaatc
acggctggcttcttcaccaacgcagcaaagaagcatcctcaggaaggttatcttacgttg
gttgatcaaaatcctgtctacatccatccatcatctgctgtattcaacaagaatcccgaa
tgggttatttatcacgaattggtgttaacaacgaaggagtacatgagaaatgtcatggtc
attgacgctaagtggttgatcgagctggcaccatccttctacaagaaggccgacccgaat
aagatgaccaagtccaaacgcatggagaagattgagcccctattcgatcgtttcaatcca
aaggattcgtggaggttatcgaggcgcaagggatag

DBGET integrated database retrieval system