KEGG   Thalassiosira pseudonana: THAPSDRAFT_268270
Entry
THAPSDRAFT_268270 CDS       T01078                                 
Name
(RefSeq) niemann-pick C type protein-like protein
  KO
K12385  Niemann-Pick C1 protein
Organism
tps  Thalassiosira pseudonana
Brite
KEGG Orthology (KO) [BR:tps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tps02000]
    THAPSDRAFT_268270
Transporters [BR:tps02000]
 Solute carrier family (SLC)
  SLC65: NPC-type cholesterol transporter
   THAPSDRAFT_268270
SSDB
Motif
Pfam: Patched Sterol-sensing ACR_tran MMPL DUF4500
Other DBs
NCBI-GeneID: 7444647
NCBI-ProteinID: XP_002287311
JGI: 268270
UniProt: B8BUG7
Position
2:1093519..1095920
AA seq 631 aa
MGNKLCGRGSRWTMAFSALMLVALSTVAGFGIASLGGLLYGPVHSVLPFVLLGIGVDDAF
VIANAFDREREGVPRDTEDDESMVKRGARALARSGASITVTSLTDLVAFAISSSSALPAL
GSFCAFASINIFFLWALSATFFTATMLLDEKRQRANRRDMLCCFTRKAIKDEEDTGSKEG
IISKYFRNYHAPAILSKPGKAICIAVFAGLFAFGVYGTTQLPVEDSSRNFIPSDSYINSY
ASAADEYFPSSGTSLHITFENGRDIYNNRESLAALDNRVKGLSKEPPYIAEPDSDSTYQN
VMTGMKIFLSTYGTGAIGNMTLGDDSWPATYDDFVQALGLYANIRGPGARYAQDVAMSSD
ASDLNAFRVKLEYVRLTKLRRGDVIDDADRQIKAMDATRDMVGSWTDLPEAFPYSEKFIT
VEGFKIINTELYRNVGLAIMAVGLIVLITVANIVTALLITVNVAFCIVEILGFMYALGLV
IDSVSVINLVLAVGLSVDYSAHIGHCFMVKGGNSRDHRATEALADIGASVLNGALSTFLA
VAVLLFSTSYVFKTLSTQFALTVGLGVVHGLVLLPVLLSLVGPHPFSSAEEPKEVEPEAT
KVIDKTEHAESFGADALQNDEDGEDVEEEEA
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgggtaacaaattgtgtgggcgtggtagtaggtggacaatggcattctcagccctcatg
ctcgtggctttgtcaaccgtggctggttttggtattgcttcattgggaggattgctttat
ggcccggttcattccgtacttccatttgtactcttgggtattggtgtggatgacgcattc
gtgattgcaaatgcttttgatagagaacgcgagggagtacctcgggatacagaagatgat
gagagtatggtgaagcgtggtgctcgtgcactggctcgttcgggtgcttccatcactgtg
acttctttgacggatctcgtggcgtttgccatctcttcatcgtcggcattgccggcattg
ggtagtttctgtgcctttgcttcaatcaacatcttctttctatgggccttgtcagctacc
ttcttcaccgcaaccatgcttttggacgagaagcgtcaacgtgccaacagaagggacatg
ctatgctgtttcactcgtaaggcaatcaaagatgaagaggacactggatcaaaggaggga
atcatctcaaagtattttagaaactaccacgctcctgccatcctatccaagcccggaaaa
gcaatctgcatcgctgtatttgcaggcctctttgcttttggagtgtacggaacaacacag
ctcccggtggaagatagctccaggaactttatcccgagtgatagttacatcaattcctat
gcttctgctgcagacgagtactttccctcgtcaggcacctctctgcacattacgttcgag
aacggcagggacatttacaacaatcgcgaaagcttggctgcactagataatcgcgtgaag
ggactaagcaaggaacctccatacatcgccgaacccgactctgactcgacttaccaaaat
gtgatgactggtatgaaaattttcttgtcaacttacggtacgggagcaattggaaatatg
acacttggcgacgactcttggccagcaacctacgacgactttgtccaggctctcggttta
tacgctaatatcagaggcccaggtgcaagatacgcacaggacgttgctatgtcgtccgat
gcatctgatctcaacgcctttagagtcaaactagagtacgttcgcttgacgaagcttcgt
agaggcgatgtcattgatgatgctgatcgtcaaatcaaggcgatggatgcaacgagggac
atggttggatcttggacggacttgccagaggccttcccttacagcgagaagttcattact
gttgaggggttcaagatcataaataccgaattgtaccgtaacgtagggttggcaattatg
gctgttggcttgatcgttctcattacggtcgcaaatatagttacggcattgttgatcacg
gtcaatgtagcattctgcattgttgagattctcggatttatgtacgctctgggattagtc
atcgactctgtttccgtcatcaacctggttcttgcagtgggtctctccgtggactattca
gctcatattggtcattgctttatggtgaagggtggaaactcacgagatcaccgtgcaaca
gaagcacttgccgatataggcgcgtcggtgctcaacggggctctcagtaccttcctagcc
gttgctgtattactctttagtacgtcatatgtgttcaagactctctcgactcagttcgcc
ttgacggttggactcggtgtggtgcacggattggttcttcttccggtacttttgtcattg
gttggtcctcatccattctcgtcagccgaagagccgaaggaagtggaaccagaagcgacc
aaagtgatcgataaaacagaacatgccgagagcttcggcgcagacgctctccaaaacgac
gaggatggtgaggacgtcgaagaagaggaggcctag

DBGET integrated database retrieval system