KEGG   Thalassiosira pseudonana: THAPSDRAFT_27557Help
Entry
THAPSDRAFT_27557  CDS       T01078                                 

Definition
(RefSeq) ABC transporter
Organism
tps  Thalassiosira pseudonana
SSDB OrthologParalogGFIT
Motif
Pfam: ABC2_membrane ABC_tran ABC2_membrane_3 AAA_21 RsgA_GTPase AAA_16 cobW AAA_22 AAA_23 AAA_25 MMR_HSR1 AAA_29 Roc AAA_18 AAA_35
Motif
Other DBs
NCBI-GeneID: 7449509
NCBI-ProteinID: XP_002288451
JGI: 27557
UniProt: B8BYH1
Position
3
AA seq 613 aa AA seqDB search
MMGISRRASTTEERRNPFAAREGNALIWTGVNMTLNKKQGERKLLNDVWGEVPPGEITAI
MGPSGAGKTSLLNILAGRCRSNSKITVESDIRMKDFKVDPTNIEVRKQIAFVAQDDSLSF
TATPREAIRFSAKLRLPRITTDDEIEELADKMLKELGLKDCADTMIGGNLIKGISGGERK
RTSVGVELVTKPSLVFLDEPTSGLDSFSAMQVIRVLKKIAHAGCSVLFTIHQPSSDVFNS
FDRLILLNKGMVMYQGPVDDVPDYFAQHNHPMPKNYNPADWIMEVAQQYSQDQLLQEGFF
SKDERNLSPAIIPKDSELLDSLGVSRHEDISDDEWKHVGFGTEARLLFKREIIHNSRNKK
GVGARFALTTFMAFLVGNIFFGVGNVDSFYDVSKFNSHFGAMVMILMMSMFGTAMPTLLS
FPEERPVFLREYSTNHYSVIAYFMSRLAMEALITFLQVFVLLIIAYFMVDLQAGFFRFLA
IEYALAMSSTAVAVLLGCAVEDPTMATEFLPLLFVPQLLFAGFFVRTDLIPPWLRWAQYL
CALTYGVRLALLAEFGDCANDETIKPNICSQLLEVNEVKEEERAIYWAILWGLFLVFRLG
GLTLLRKKATKFY
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgatggggatatctcgacgtgcttctactacggaggagaggaggaatccttttgctgcg
agagaggggaacgctttgatttggaccggtgtcaacatgaccttgaacaaaaagcaaggc
gagaggaaactactcaacgatgtttggggagaggtgccgccaggagaaatcacagccatc
atgggtccttcgggggcaggaaaaacctccttgttgaacatccttgcaggacgctgtaga
tccaactccaaaatcactgttgaatctgatatccgtatgaaggacttcaaagtagaccca
accaatattgaagttcgcaaacagatcgcttttgtagcccaagacgattctctatcattc
acagcaactcccagagaagctattcgttttagtgccaagttgcgtttgcctagaattact
accgatgatgaaattgaggagttggcggataagatgttgaaagagttggggttgaaagat
tgtgctgatacgatgattggagggaacttgattaaaggcatttcgggaggtgagcggaag
agaacaagtgtgggtgtagagctggttacgaaaccttcgttggtgttcttggatgagcca
actagtggacttgattccttctctgcaatgcaggtgattcgggtcctaaagaagattgct
catgctggatgctcggtactcttcacaattcaccaaccttcctcggacgtcttcaatagt
tttgataggcttattctcttgaataaaggaatggtcatgtaccaggggccagtggatgac
gtgccggattactttgcacaacacaatcacccgatgccaaaaaattataatcctgcagat
tggattatggaggtggcacaacaatactcacaggatcagttgttgcaggagggtttcttt
tctaaagacgaacgcaacctttctcctgcaataatcccaaaagattcggaactgttggat
tcactgggggtttcgaggcacgaagatattagcgatgatgagtggaaacatgttgggttt
ggaacggaagcccggttgctcttcaaacgagagatcattcacaattctagaaacaaaaaa
ggagttggtgcacgatttgctttgacgacgttcatggccttcttggttgggaacatattc
tttggtgtaggcaacgttgattcattctacgatgtttcgaaattcaacagccactttggg
gctatggtcatgatcttgatgatgtccatgtttggaacggcaatgccgaccctcctatct
ttcccagaggagcgccctgtctttttgagagagtactcaaccaaccactacagcgtcatt
gcatatttcatgtcacgtcttgcaatggaggctttgatcaccttcctccaagttttcgta
ctgctaatcatcgcgtacttcatggtggatctacaagctggctttttcagattccttgca
atcgagtatgcattggcaatgagtagtacagccgtcgccgtactcctgggatgtgccgtc
gaagatcccacgatggcaaccgagttcctccctctcctctttgtacctcagcttctgttc
gctggattctttgttcgtaccgatttgatccctccatggttacgatgggcacagtatctg
tgtgcgttgacgtacggagttcgtttggctcttcttgcagagtttggggattgtgccaat
gacgaaacgataaaacctaatatctgttctcaattgttagaagtcaatgaagtgaaagag
gaagagagagcaatttattgggctattctttggggcttgttccttgtgttccgtcttggt
gggcttacgttattgcggaagaaagcaaccaagttctattga

DBGET integrated database retrieval system