KEGG   Thalassiosira pseudonana: THAPSDRAFT_34227Help
Entry
THAPSDRAFT_34227  CDS       T01078                                 

Definition
(RefSeq) hypothetical protein
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
tps  Thalassiosira pseudonana
Pathway
tps03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:tps00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    THAPSDRAFT_34227
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tps01009]
    THAPSDRAFT_34227
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tps03036]
    THAPSDRAFT_34227
Protein phosphatases and associated proteins [BR:tps01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     THAPSDRAFT_34227
Chromosome and associated proteins [BR:tps03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     THAPSDRAFT_34227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: B56 Na_H_Exchanger Trp_repressor
Motif
Other DBs
NCBI-GeneID: 7451793
NCBI-ProteinID: XP_002290606
JGI: 34227
UniProt: B8C2C0
Position
5
AA seq 423 aa AA seqDB search
LPALRDAPPNKREELFKLKLQLCGVIFSFDDPTSDKRGKDMKRQTLLELVDYVNTPAGQK
IFTESVMSDLMAMVSANVCRALPPATDDFDPEEDEPVLEPAWPHLQVAYEFFLRFIVSSE
VNAKAAKKYVDQRFCLQLVELFDSEDPRERDYLKTILHRIYGKFMSHRSFIRRAISNVFY
RFVYETERHNGIGELLEILGSIINGFAIPLKKEHLQFLVRALIPLHKPKCVGLYHQQLSY
CIIQYVEKDADTATPILNGFFKCWPWSCSGKQVLFLNELEEILELLGADQLNQISKTLFT
NLARCLDSDHFQVVERALFLWNNEHLVNSGCLSRLNAQTVLPIIYGPLYKNSSGHWNATV
EGLAQNVLKMYMEYDLVLYDQCTTAYFKEEEDAKKKIQAIADRWQVIEEMAETNKRQRMI
TAA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
cttcctgccttgagggatgcccctcctaacaagcgtgaggaactcttcaagttgaagctt
caactttgtggtgtcatcttttcgtttgatgatcccacctctgacaagcgtggaaaggat
atgaaacgccagactttgcttgaattggttgactacgttaacactcctgctggacagaag
atcttcactgaatccgtcatgtctgacctcatggccatggtgtccgccaacgtatgccgc
gcccttcctcccgctactgacgactttgatcctgaagaggatgagccagtcctcgaacct
gcatggcctcaccttcaagtcgcctacgagttcttccttcgtttcatcgtgagctctgaa
gtgaatgccaaagcagccaagaagtatgtcgaccaacgcttctgccttcagcttgtggag
ttgtttgattctgaggatcctcgagaacgcgactacctcaagacgattcttcatcgtatc
tacggaaagttcatgtctcacagatcttttatccgcagggcaatctccaatgtcttctac
aggtttgtgtacgagacggaacgtcacaatggtatcggtgaattgcttgagattcttgga
tccatcatcaacggatttgctatccctctgaagaaagagcatttgcaattccttgttcgt
gccttgattcctcttcacaagcccaagtgtgttggactctaccaccagcagctgtcttac
tgcatcatccaatacgtcgagaaggatgcagacaccgctactcccatcctcaatggcttc
tttaaatgctggccttggtcgtgctctggaaagcaggtgttgtttttgaatgagttggag
gagattcttgagttgctcggagccgatcaactcaaccagattagcaagacgttgttcacc
aatcttgctagatgtcttgactcggatcacttccaagtggtggaacgagctctcttcctg
tggaacaatgagcaccttgtgaacagtggttgcttgtcgaggttgaatgctcagactgtg
ttgcccataatctatggccctctctacaaaaacagctctggacattggaatgccactgtt
gagggattagcgcagaatgtactgaagatgtacatggaatacgatcttgttctatatgat
caatgcactaccgcgtactttaaggaggaagaggatgcaaagaagaagatccaggctatc
gcggatcgttggcaagtcattgaggagatggcagaaactaacaagcgtcagagaatgatt
accgctgcttag

DBGET integrated database retrieval system