KEGG   Thalassiosira pseudonana: THAPSDRAFT_35929Help
Entry
THAPSDRAFT_35929  CDS       T01078                                 

Gene name
MAPKKK
Definition
(RefSeq) mitogen activated protein kinase-like protein
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
tps  Thalassiosira pseudonana
Brite
KEGG Orthology (KO) [BR:tps00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tps01001]
    THAPSDRAFT_35929 (MAPKKK)
   01009 Protein phosphatases and associated proteins [BR:tps01009]
    THAPSDRAFT_35929 (MAPKKK)
Enzymes [BR:tps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     THAPSDRAFT_35929 (MAPKKK)
Protein kinases [BR:tps01001]
 Serine/threonine kinases: Other
  Wnk family
   THAPSDRAFT_35929 (MAPKKK)
Protein phosphatases and associated proteins [BR:tps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     THAPSDRAFT_35929 (MAPKKK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Haspin_kinase Lipase_GDSL
Motif
Other DBs
NCBI-GeneID: 7452376
NCBI-ProteinID: XP_002292143
JGI: 35929
UniProt: B8C7K0
Position
8
AA seq 285 aa AA seqDB search
LQQSTIVEKSPAERYIRFKEKLGSGAYKDVYRAYDTIEGIEVAWNVVKLGGVPKAERIRI
VNEVRLLERLHHPNIISFHGSWVNRETERVIFVTEILSSGTLKSFVQKVQLIRWKIFKRW
AIQILKGLEYLHSQDPPIIHRDLKCDNIFINGTSGDLRIGDFGLSTAISKKNQVSCVLGT
PEFMAPELYDENYNEKVDVYAFGMLLLEIITNQVPYHECTNPAQIYKKVTQGIPPASLRR
VKSENARNFILLCLGIGKDASERPSATELLNHQFLVKRADDDNTI
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ctccaacaatctacaatcgttgaaaagtcccccgccgaacgatacattcgcttcaaagaa
aagcttggctctggtgcctacaaagacgtctatcgtgcgtatgataccattgaggggatt
gaagttgcgtggaacgtagtcaagttggggggagtgcccaaggcggaacgtatacggatt
gtcaatgaagttcgattgctggaacgactgcatcatcctaatatcatctcgtttcatgga
tcgtgggtcaatagagagacggagcgagttatctttgtgacggagatattatcctcggga
actctcaagtcgtttgtgcaaaaggtgcagctgattcggtggaagatattcaagaggtgg
gctattcagatattgaaggggttggagtatttgcattcacaggatccaccgattatccat
cgggatttgaagtgtgataatatctttatcaatgggactagcggggatttgaggatcggg
gattttggtctgagtactgcaattagcaagaagaatcaggtcagttgtgtgcttggcacg
ccagagttcatggcgcccgaactctacgacgagaactacaacgaaaaggtcgacgtttat
gcattcgggatgctcctccttgaaatcatcaccaatcaagtgccttaccacgaatgtaca
aaccctgctcaaatctacaaaaaggtcacacagggcattccaccggctagtttgcgtcga
gtcaagtcggagaatgcaaggaacttcatcttgctgtgtcttgggattggcaaagatgcc
agtgaacgaccgtcagccacggagcttctgaatcatcaatttctggtgaagcgtgccgat
gacgataacactatt

DBGET integrated database retrieval system