KEGG   Thalassiosira pseudonana: THAPSDRAFT_37571Help
Entry
THAPSDRAFT_37571  CDS       T01078                                 

Definition
(RefSeq) pyruvate dehydrogenase kinase
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     THAPSDRAFT_37571
Protein kinases [BR:tps01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   THAPSDRAFT_37571
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 7449493
NCBI-ProteinID: XP_002294094
JGI: 37571
UniProt: B8CDF6
Position
15
AA seq 338 aa AA seqDB search
SEATPLVLLQVASFLRRELPIRLAHRIQDLSRVPLLQDMKSVQQVKELYTTSFLEIMSVD
KHPPTREGQEEWEEHFAKILENIYERHSSVLVQMARGAFELRRDAVEFELMESTHAFLDR
FYISRIGIRVLIGQYLSLRQPPVENYVGIICSKTSPYEIVKRAIDDAAFMCTRKYGDAPE
VIITGRLDMTFPYVPTHLHYIMLELLKNSMRATVEYHGVDADYPPIKVVIADGKDNEDVI
IKVSDEGGGIPRSNMKRIWSYLFTTADPEIQEGMVAFNENVDHSIDSPLAGLGYGLPISR
SYTRYFGGDLSIMSMEGYGTDCFVYLTRLGNTREPLPI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
tcggaggcgactcccctggtgttgctgcaggtggcttctttcttacgtcgcgagctgccc
attcgactggcacaccgtattcaggatctatctcgcgtgcctctacttcaagatatgaaa
tctgtacaacaagtgaaggaattgtataccacatccttccttgagataatgtcagttgac
aaacaccctcccacgcgagaggggcaggaagagtgggaagaacactttgcaaagatccta
gaaaatatatacgagagacattcttctgtattggtccaaatggcacggggggcatttgaa
ctgcgtcgagatgcagtggaatttgaacttatggaatcaacgcacgcttttcttgataga
ttctacatctcacgtattggaatacgagtgttgattggtcagtatttgtctttgaggcag
cctccggtggagaattatgtggggattatttgcagtaagacaagtccgtatgagattgtc
aagagggcgattgatgatgctgcttttatgtgtacgaggaagtatggggatgccccggag
gtgattattacgggcagattggacatgacgtttccctacgtcccaactcatcttcattac
atcatgttggagcttctcaaaaactcaatgcgagccacggttgaataccatggagtcgat
gcagactatcctccgattaaggttgtaattgcagatgggaaagataacgaggatgtaatt
atcaaggtgtcagacgagggtggtgggattccgaggagtaacatgaagagaatttggagc
tacctcttcactacagctgatccagaaatccaagaggggatggttgccttcaatgaaaat
gtagatcacagtattgattctccgttggcagggttagggtatggattaccgattagtcga
agctatacaaggtatttcggtggtgatctgagcatcatgagcatggaggggtacgggacg
gattgctttgtgtacttgacacgtttggggaacacgagggagccactgccaatctaa

DBGET integrated database retrieval system