KEGG   Thalassiosira pseudonana: THAPSDRAFT_40391Help
Entry
THAPSDRAFT_40391  CDS       T01078                                 

Gene name
ENO1
Definition
(RefSeq) alpha enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
tps  Thalassiosira pseudonana
Pathway
tps00010  Glycolysis / Gluconeogenesis
tps01100  Metabolic pathways
tps01110  Biosynthesis of secondary metabolites
tps01130  Biosynthesis of antibiotics
tps01200  Carbon metabolism
tps01230  Biosynthesis of amino acids
tps03018  RNA degradation
Module
tps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tps_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THAPSDRAFT_40391 (ENO1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    THAPSDRAFT_40391 (ENO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tps03019]
    THAPSDRAFT_40391 (ENO1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tps04147]
    THAPSDRAFT_40391 (ENO1)
Enzymes [BR:tps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     THAPSDRAFT_40391 (ENO1)
Messenger RNA biogenesis [BR:tps03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     THAPSDRAFT_40391 (ENO1)
Exosome [BR:tps04147]
 Exosomal proteins
  Proteins found in most exosomes
   THAPSDRAFT_40391 (ENO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-GeneID: 7446146
NCBI-ProteinID: XP_002289866
JGI: 40391
UniProt: B8BZT5
Position
4
AA seq 440 aa AA seqDB search
MSAITGIHGREIIDSRGNPTVEVDITTAQGTFTASVPSGASTGAYEAVELRDGGSRYLGK
GVSQAVNNVNTVLADAVKGIDVADQRAVDDAMLKADGTPNKGNLGANAILGISLAASKAG
AAAKGVPLWKHYADIAGNPTPDVLPVPCFNVINGGEHAGNKLAFQEFFVIPTGAETFSES
MQIGCEVFHNLKKVIKAKFGGDATLIGDEGGFAPPCDVESGLEMIMEATEAAGYLDKVSV
GLDVASSEFKVPGKNQYDLDFKTKGADKDSSLLLSGDELIAFYKQLIDKYPIVTIEDPFD
QDDWDNWTKICKEVGKDVQIVGDDLTVTNPVKIQEAINLGSANCLLLKVNQIGSISESID
AVKLSKQNGWGVMCSHRSGETEDFYIADLAVGLCTGEIKTGAPCRGERTAKYNQLLRIEE
QLGAAAKYPGASFRNPGWMG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccatcaccggcatccatggtcgcgagatcatcgactctcgtggtaaccccact
gtcgaagtcgacattaccactgctcagggcactttcactgcaagtgtcccctctggtgca
tccaccggtgcctacgaggccgtggagcttcgtgatggaggatctaggtaccttggaaag
ggagtttctcaggccgtgaacaatgtcaacactgtgcttgcggatgctgttaaggggatt
gatgttgctgaccagagggcggttgatgacgccatgttgaaggccgatggaactcctaac
aagggaaaccttggagccaacgccattcttggaatctccctcgctgccagtaaggccgga
gccgccgccaagggagttcctctttggaagcattatgctgacattgctggaaaccccacc
cccgatgttcttcccgttccatgcttcaatgttatcaacggaggagagcacgctggaaac
aagcttgctttccaggaattctttgtgattcctaccggagctgagactttcagtgagtcc
atgcaaattggatgtgaagtattccacaatcttaagaaagtgattaaggccaagttcggt
ggagatgctactcttattggagatgagggtggatttgctcctccctgtgacgtcgagtct
ggtttggaaatgatcatggaggctaccgaggctgctggataccttgacaaagtgagcgtt
ggacttgatgttgcatcctctgagtttaaggttcccggaaagaaccagtacgatcttgat
ttcaagacgaagggagctgacaaggattcttccctcttgctcagtggagatgaacttatt
gctttctacaagcagttgattgacaagtaccccattgtcactatcgaggatccctttgac
caggacgactgggacaactggaccaagatctgtaaggaggttggaaaggatgttcagatt
gttggagacgatcttactgttaccaaccccgtcaagatccaggaggctatcaaccttgga
tctgctaactgcctccttcttaaggtcaaccagattggatccatctccgagtccatcgat
gctgtcaagctttctaagcaaaacggatggggagtcatgtgcagtcacaggagtggagag
accgaggacttctacattgctgatcttgccgttggtctttgcactggagagattaagact
ggagctccttgccgtggagagcgtactgctaagtacaaccagcttcttcgtattgaagag
caactcggagctgctgccaagtaccctggtgcctctttcagaaaccctggatggatggga
taa

DBGET integrated database retrieval system