KEGG   Thalassiosira pseudonana: THAPSDRAFT_6290Help
Entry
THAPSDRAFT_6290   CDS       T01078                                 

Gene name
NDK2
Definition
(RefSeq) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
tps  Thalassiosira pseudonana
Pathway
tps00230  Purine metabolism
tps00240  Pyrimidine metabolism
tps01100  Metabolic pathways
tps01110  Biosynthesis of secondary metabolites
tps01130  Biosynthesis of antibiotics
Module
tps_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
tps_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
tps_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:tps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    THAPSDRAFT_6290 (NDK2)
   00240 Pyrimidine metabolism
    THAPSDRAFT_6290 (NDK2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tps04131]
    THAPSDRAFT_6290 (NDK2)
Enzymes [BR:tps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     THAPSDRAFT_6290 (NDK2)
Membrane trafficking [BR:tps04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    THAPSDRAFT_6290 (NDK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 7445999
NCBI-ProteinID: XP_002291121
JGI: 6290
UniProt: B8C642
Position
6
AA seq 152 aa AA seqDB search
MNASERTYIMIKPDGVQRGIVGNIISRFETKGYKLVALKTKQATKELLDTHYCDLVEKPF
FPKLRDYMMSGPVVSMIWEGKEAVATGRKMLGATNPLASEPGTIRGDFCIEVGRNICHGS
DSVENAEKEIALWFEESELLDWESHSKDWIYE
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcctcggagcgcacttacataatgatcaagcctgatggagttcagagaggtatc
gtcggtaacatcatctctcgatttgagaccaagggatacaagcttgttgccttgaagacc
aagcaggctacgaaggagcttcttgatactcactactgtgacctcgtggaaaagcccttc
ttccccaagcttcgtgactacatgatgtctggacccgtcgtcagcatgatctgggaagga
aaggaggcagttgccactggacgtaagatgctcggagccaccaatcctctcgcctcggaa
cccggaactatccgtggagacttttgcattgaggttggaaggaacatttgccacggaagt
gactctgttgagaatgccgagaaggagattgccttgtggtttgaggagagtgaattgctt
gattgggaatctcactctaaggactggatctacgagtaa

DBGET integrated database retrieval system