KEGG   Thalassiosira pseudonana: THAPS_10811
Entry
THAPS_10811       CDS       T01078                                 

Definition
(RefSeq) predicted protein
  KO
K12603  CCR4-NOT transcription complex subunit 6 [EC:3.1.13.4]
Organism
tps  Thalassiosira pseudonana
Pathway
tps03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:tps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    THAPS_10811
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tps03019]
    THAPS_10811
Enzymes [BR:tps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     THAPS_10811
Messenger RNA biogenesis [BR:tps03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     THAPS_10811
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     THAPS_10811
SSDB
Motif
Pfam: Exo_endo_phos zf-C6H2 Rubi_NSP_C
Other DBs
NCBI-GeneID: 7442937
NCBI-ProteinID: XP_002295532
JGI: 10811
UniProt: B5YLK3
Position
18
AA seq 590 aa
MYGKKLDERDLDKVSNNPNHTKICREPPPNHEFSYRWFRGPTVEPCAYEGCPRRTSFSPH
DWSKHALGGSGCSLQCVSTQSSLYKATFCNANCFVKAWKTQYTVQSDVPQARSSTPQRRR
LGSYADDDDTRSVNSVNSGRSDYNPPGTPREITVGGNANTPRGNNGGYNDHHGQSEEWIE
ISRDQLYVPNENDVGRKLKLEAAAYAIDSGELLMHRVVKTDLVLSRTSELDKRNFITSKP
SGGGGARFRIVTYNILAEIYATQQQYPHADLWSLSWDFRFQNIIREIVDVGPDIVCLQEV
QADHYESHLYNAMHDAGFEGVFKQKTRQSMGMTGKVDGCALFWRRTKFHLIESYSIEFNE
LAQRQVTQVMGLNPRSEEGAAILSKLSKDNVAQLVVLELAQQSISRSSREPINQVCIANT
HLYSNKDYPDVKLWQTLHLLQELETFIMARGTNLPLMICGDFNSTPDTAVYDLLSRQAVH
PGHPDVNLGDDNGPNVLPDIMNITHSHMLGSVYNTVLGEEPKFTNYTMQFKGVLDYMWYS
TQNLRPLSAAPIPDESVLTRYGDALPSTQYSSDHIMQISDMQIVSVGRPP
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgtacggtaaaaagctcgacgaacgcgatctagacaaagtatcaaacaaccccaaccac
accaaaatctgccgcgaaccaccacccaaccacgagttctcctaccgctggttccgcggc
ccaacggtagaaccctgcgcttacgaaggatgccctcgtcgtacatccttctctcctcat
gattggtcaaagcatgccttggggggatcaggctgttctttgcaatgtgtctctactcag
agttcgttgtacaaggccacgttctgtaatgccaattgttttgtcaaggcttggaagaca
cagtatactgttcagagtgatgttccgcaggctaggagctcgactccacaacgtcgtagg
ttgggatcgtatgcagatgatgatgatactcggagtgtgaatagtgtcaatagtgggaga
tcagattataaccctccagggactccccgtgaaatcaccgtgggggggaatgcaaacact
cctcggggtaacaatggcggatacaatgatcatcatggacagtcggaggaatggattgaa
atcagtcgtgatcagctctatgttccaaatgagaatgacgtggggaggaagttgaaactg
gaggcagccgcatacgcaattgattcgggggagctattgatgcacagagtggtaaagacg
gatttggtattgagtaggacttctgagttggataagaggaatttcatcacgtcgaagcca
agtggaggggggggggctcggttccgtattgttacatacaatatcttggcggagatttat
gctacgcagcagcagtatcctcatgctgatctttggtcattgtcgtgggactttcgtttt
caaaacatcatcagagagattgtggatgtcggtccggatatcgtctgtttgcaggaggtg
caggcagatcattacgaaagtcatctttacaatgcaatgcacgatgctggatttgaggga
gtcttcaagcaaaagactcgtcagtcgatgggaatgactggcaaggtggatggatgtgca
ttgttctggagaaggacgaaattccatttgattgagtcgtacagtattgaatttaatgag
ttggctcaacgacaggtgacgcaggtgatgggattaaatcctcggagtgaagagggggca
gccattttgagtaagctgtcgaaggataatgtggctcagcttgtggtgttggagcttgct
cagcagtcgatttcgaggtcgagtcgggagccgatcaatcaagtgtgcattgccaacact
cacctctacagcaacaaagattatcccgatgtgaagctttggcaaactttgcatctgctg
caggagttggagacattcatcatggcgagggggactaacttgcctctcatgatttgtggt
gatttcaactccactccggatactgccgtgtacgatcttctatctcggcaggctgtgcac
ccaggccacccggatgtcaacttgggtgatgacaatggtccaaatgttttgcctgacatt
atgaacattactcactcgcacatgctcggcagtgtctacaacactgtccttggtgaagaa
cccaagttcaccaactacaccatgcagttcaaaggcgtcttggactacatgtggtactca
actcaaaacttgagacctctttcggcagcaccaattccggacgaaagtgttctcactcgg
tatggagatgctttaccctcgacacagtacagctcggaccatatcatgcagatttcggat
atgcagattgttagtgtggggaggcctccgtaa

DBGET integrated database retrieval system