KEGG   Thermotoga petrophila: Tpet_0766Help
Entry
Tpet_0766         CDS       T00525                                 

Definition
(GenBank) non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
tpt  Thermotoga petrophila
Pathway
tpt00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:tpt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Tpet_0766
Enzymes [BR:tpt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     Tpet_0766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: ABQ46785
UniProt: A5IKR2
Position
778711..779301
Genome map
AA seq 196 aa AA seqDB search
MKKLTVYLATTNPHKVEEIKMIAPEWMEILPSPEKIEVVEDGETFLENSVKKAVVYGKKL
KHPVMADDSGLVIYSLGGFPGVMSARFMEEHSYKEKMRTILKMLEGKDRRAAFVCSATFF
DPVENTLISVEDRVEGRIANEIRGTGGFGYDPFFIPDGYDKTFGEIPHLKEKISHRSKAF
RKLFSVLEKILESENR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgaccgtctaccttgcaacgacgaatccgcacaaagttgaagaaataaag
atgatcgctccagaatggatggagattctgccctctcccgaaaaaatcgaagtagtcgag
gacggtgaaacgtttctggaaaactccgtgaaaaaggccgtggtctacgggaaaaaactc
aaacatcctgtgatggcggacgattccggactggtcatctattccctgggaggattcccc
ggtgtcatgtctgcccggttcatggaggaacattcctacaaagagaagatgagaaccata
ctgaagatgcttgaaggaaaagatagaagagctgctttcgtgtgcagtgctacctttttc
gatcctgtggaaaacacccttatttctgttgaagacagagtagaaggccgaatagccaac
gaaataagagggacaggcggtttcggatacgatccgttcttcataccggatggatacgat
aagaccttcggcgaaattcctcatctcaaagaaaaaatcagtcacagatcaaaggccttc
agaaagctcttttcggttcttgagaagatcttagaatcagaaaaccggtga

DBGET integrated database retrieval system