KEGG   Thermotoga petrophila: Tpet_0787Help
Entry
Tpet_0787         CDS       T00525                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tpt  Thermotoga petrophila
Pathway
tpt00260  Glycine, serine and threonine metabolism
tpt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tpt01100  Metabolic pathways
tpt01110  Biosynthesis of secondary metabolites
tpt01130  Biosynthesis of antibiotics
tpt01230  Biosynthesis of amino acids
Module
tpt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tpt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tpet_0787
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tpet_0787
Enzymes [BR:tpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tpet_0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Cas_APE2256
Motif
Other DBs
NCBI-ProteinID: ABQ46806
UniProt: A5IKT3
Position
799500..800669
Genome map
AA seq 389 aa AA seqDB search
MKGYFGPYGGQYVPEILMPALEELEAAYEGIMKDGSFWREFNDLLRDYAGRPTPLYFARR
LSEKYNARIYLKREDLLHTGAHKINNAIGQVLLAKRMGKTRIIAETGAGQHGVATATAAA
LFGMECVIYMGEEDTIRQKPNVERMKLLGAKVVPVKSGSRTLKDAINEALRDWITNLQTT
YYVIGSVVGPHPYPIIVRNFQKVIGEETKKQILEKEGRLPDYIVACVGGGSNAAGIFYPF
IDSGVKLIGVEAGGEGLETGKHAASLLKGKIGYLHGSKTFVLQDDWGQVQVTHSVSAGLD
YSGVGPEHAYWRETGKVLYDAVTDEEALDAFIELSRLEGIIPALESSHALAYLKKINIKG
KVVVVNLSGRGDKDLESVLNHPYVRERIG
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttactttggtccttacggaggtcagtacgttcccgagattctcatgcctgcc
cttgaagaactcgaggcggcttacgagggaatcatgaaggatggatcgttctggagagag
ttcaacgaccttctaagggattacgctggacgccccactcctctttacttcgccagaagg
ttgagtgaaaagtacaacgccaggatttatttgaagcgtgaagatcttcttcacacaggt
gctcacaagataaacaacgccataggtcaggtgcttctcgcgaagaggatgggaaaaaca
agaataatagcggaaacaggagcggggcagcacggcgttgccaccgcgacggccgctgcg
ctctttggaatggagtgcgtcatatacatgggcgaagaagacacgatcagacagaaaccc
aacgttgagagaatgaaactcctcggcgcgaaagtggttcccgtgaagagcggaagcaga
acgctgaaagacgccataaacgaagcccttcgggattggatcacgaaccttcagaccacc
tactacgttatcggatccgtcgtgggacctcacccgtatccgatcatagtgagaaacttt
cagaaggtgattggtgaggaaacaaaaaagcagatccttgagaaggaagggagattgccg
gattacatcgttgcgtgtgttggaggaggaagcaacgctgccggtatcttctacccgttc
atagattccggtgtgaagctgatcggagtggaagccggtggagaaggcctcgaaaccgga
aagcacgcagcttctcttctcaaagggaaaattggatacctacacggaagtaagaccttc
gttcttcaggatgactggggccaggttcaggtgacacactcggtttcggcgggactggac
tattccggtgtggggcctgaacacgcttattggagggagactggaaaagttctgtacgat
gcggtgacggatgaagaagctctcgatgccttcatcgaactttcaaggctggaagggatc
attccagcactcgaaagctctcacgcactggcttacctgaagaagatcaatataaagggt
aaggtcgtcgttgtgaacctttcagggcgcggcgacaaggatttagaatcagttttgaac
catccgtacgtcagggagaggataggatga

DBGET integrated database retrieval system