KEGG   Thermotoga petrophila: Tpet_1400Help
Entry
Tpet_1400         CDS       T00525                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tpt  Thermotoga petrophila
Pathway
tpt00900  Terpenoid backbone biosynthesis
tpt01100  Metabolic pathways
tpt01110  Biosynthesis of secondary metabolites
tpt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tpt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tpet_1400
Enzymes [BR:tpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Tpet_1400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABQ47413
UniProt: A5IMJ0
Position
complement(1392336..1393151)
Genome map
AA seq 271 aa AA seqDB search
MVENIGNGSAELVSYAKLNLYLDVLGKRSDEYHEIVGLFQTISLHDTLTVEICDGGFYLE
SNVALPSDNTIKRAWEMFRKNTGEEFGLKVTLKKKVPVGSGLGGGSSNAAAILRYLGEVF
KIPLEDLLNIAAQVGSDVPFFLYGGTALVRGRGEIVEKLEDIEGYSVNLFFPGIHSSTKE
MYLSLTPEMYRKGPGRVEELHRAYLERDYEKIRKLSYNVFEKVFLEKHPEVMYGLRNFGD
GSIVKMMTGSGSAFFALYPLDEGNYPFVGGV
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttggtcgaaaatatcggcaacggttctgctgaacttgtttcgtacgcaaaactgaatctc
tacctggatgtgcttggaaaaagatccgatgaataccacgaaatagtgggattgtttcaa
acgatttctcttcacgacacactcactgtagaaatctgtgatggaggtttctacctggaa
agcaacgtagctctgccctcggacaacacgatcaaaagagcctgggagatgttcaggaaa
aacacaggagaagaattcggcctcaaagtcacgttgaaaaagaaggtcccagtaggctct
ggccttggaggagggagttccaacgctgcagcgattctcagatatcttggtgaagttttc
aaaatacctcttgaagaccttctgaatatagcagctcaggtgggaagcgatgtacccttt
tttctttacggaggaaccgctcttgtgagaggaagaggagaaatcgtggaaaaactcgaa
gatattgaagggtactctgtcaatctgttcttcccgggcattcactcttcaacgaaagaa
atgtatctgtctctcacaccagagatgtacagaaaaggacccggcagggtagaggaacta
cacagggcttatcttgaaagggattacgaaaagataaggaaactctcctacaacgtgttt
gagaaggtgttcttagagaaacacccggaggtaatgtatggactgagaaactttggcgat
ggttccatagtgaaaatgatgacgggaagcggaagtgcctttttcgctctctaccctcta
gacgaaggaaattacccgtttgtgggaggtgtttaa

DBGET integrated database retrieval system