KEGG   Tatumella ptyseos: NCTC11468_01543Help
Entry
NCTC11468_01543   CDS       T05493                                 

Gene name
icd_1
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
tpty  Tatumella ptyseos
Pathway
tpty00020  Citrate cycle (TCA cycle)
tpty00480  Glutathione metabolism
tpty01100  Metabolic pathways
tpty01110  Biosynthesis of secondary metabolites
tpty01120  Microbial metabolism in diverse environments
tpty01130  Biosynthesis of antibiotics
tpty01200  Carbon metabolism
tpty01210  2-Oxocarboxylic acid metabolism
tpty01230  Biosynthesis of amino acids
Module
tpty_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tpty_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:tpty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCTC11468_01543 (icd_1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NCTC11468_01543 (icd_1)
Enzymes [BR:tpty01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     NCTC11468_01543 (icd_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: SQK74409
UniProt: A0A2X5NLZ8
Position
1:1403558..1404625
Genome map
AA seq 355 aa AA seqDB search
MESKVVIPAEGQKITLQQGKLVVPENPVIPYIEGDGIGVDVSPVMLKVVDAAVEKAYQGK
RKISWLEIYTGEKSVELYGPDVWLPQETLDLIKEYRVAIKGPLTTPVGGGIRSLNVALRQ
QLDLYICLRPVRYYRGTPSPVKRPEDTDMVIFRENSEDIYAGIEWKAGSAEADKVINFLR
EEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAVEYTIANNRDSLTLVHKGNIMKFTEGA
FKDWGYQLVKEEFGGELLDGGPWMTFKNPNTGKDIIVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPERTSVMNVHCLKPPTEPHQNMPARIKLTLAQ
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagttgtcattccggcggaaggtcagaaaatcaccctgcagcagggtaaa
ctggttgttcctgaaaacccggtgatcccttacatcgaaggggacggaattggtgttgat
gtttctccggtaatgttaaaagtcgttgatgccgcggtagagaaagcctaccagggcaaa
cgtaagatttcatggctggaaatctacaccggtgaaaaatccgttgagctgtatggcccg
gatgtctggttgccacaggaaaccctggacctgatcaaagaataccgcgttgccattaaa
ggcccattgaccactcctgtaggcggcggtatccgttctctgaacgtggcactgcgtcag
caactcgatttgtacatctgtctgcgtcctgtccgctactaccgcgggaccccaagcccg
gtaaaacgtcctgaagatactgatatggtcatcttccgtgagaactctgaagatatctat
gccggtatcgaatggaaagccggcagcgcagaagcagataaagtgatcaacttcctgcgt
gaagaaatgggtgtgaagaagatccgtttccctgagcagtgtggtatcggggtcaaaccg
tgttctgaagaaggtaccaagcgactggtgcgtgcagcggtggaatacaccattgctaat
aaccgcgactccctgacgctggttcacaaaggcaacattatgaaattcaccgaaggtgct
ttcaaagactggggctaccagttagtgaaagaagaattcggcggtgaattgctggatggc
ggcccgtggatgacctttaaaaacccgaacaccggcaaagacattattgtcaaagacgtt
atcgccgatgccttcctgcaacagatcctgctgcgtccggcagaatatgatgtgattgcc
tgtatgaacctgaacggcgactacatttcagatgcgctggcagcacaggtgggcgggatt
ggtattgctccggagcgaacatcggtgatgaatgtgcactgtttgaagccacccacggaa
ccgcaccaaaatatgccggccaggataaagttaaccctggctcagtga

DBGET integrated database retrieval system