KEGG   Theileria parva: TP01_1212Help
Entry
TP01_1212         CDS       T00254                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tpv  Theileria parva
Pathway
tpv00450  Selenocompound metabolism
tpv00970  Aminoacyl-tRNA biosynthesis
tpv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    TP01_1212
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TP01_1212
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tpv01007]
    TP01_1212
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tpv03016]
    TP01_1212
Enzymes [BR:tpv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     TP01_1212
Amino acid related enzymes [BR:tpv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   TP01_1212
Transfer RNA biogenesis [BR:tpv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TP01_1212
 Prokaryotic type
   Other AARSs
    TP01_1212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 3502387
NCBI-ProteinID: XP_766733
UniProt: Q4N6F8
Position
1
AA seq 563 aa AA seqDB search
MQILFNNANGSVNFTKILFFHLIILNFSLSFRIPNTFKRDSSFLTHHSLNPRLNDKFSVN
LFSDPGVSSGNKYLITTPLFYLNGPPHLGHAYTLVSSDVLKRFLILSGHDCKLLAGTDEH
GSKIKTTAANFGYSPKEYVISMRNQFFKLYKAYDITPEIVVHTSENEHKSKVKRVFDNFL
ESGHIYRGLHRGYFSPKEDLYYTESKLINGKSPLGFDVTLVDEPAYFFKLDIWKRKLVEF
FKDSEVILPQHSLNEVRKLLQSEINDIAITRSNCDWGIPITNSGNETVYVWFDALLGYLT
HLHSFPPLEQSNSNLNGLKIIHVIGKDILTFHTILWPAILMALKLDIKLRFLVHGWLLNK
GEKISKSLNNSISPLNTSVPSDVSRFALMNLGDFSYDFEFDPSMFDNALKTLRNKFANTF
YRVTSILQMNKVDTVQPCDCDHKLLEKFNKYSEEIRNSVQSFRLDRYIQILVEMSSEVNK
FIELTQFWTMSSQSELLNTSWICCTLLLYISIYLAPITPKLANDMILRLGPQLSGAPVKT
ISFNLLDDIQHISYNPKHLNPLI
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgcagattctgtttaataatgccaatggtagtgtaaattttactaaaattttatttttt
cacttgattatactcaatttctcactctcattccggattccaaatacattcaaaagggat
tcttcatttctaacacatcactcacttaatcctagattaaatgataaattttctgtaaat
cttttttctgaccctggagtatcttctggtaacaaatatttaataactactccgttgttt
tatttaaatggcccacctcatttgggccatgcttacacattagtatcttctgatgtgctt
aaaaggttcctaattctcagtggccatgactgtaaattactcgctggcactgatgaacat
ggttctaagatcaagacaaccgctgccaatttcggctattctcctaaagaatatgtcatt
tccatgagaaatcaattctttaaactttataaagcttatgatattacccccgaaattgta
gttcacacttcagaaaatgagcataaatctaaggtcaaacgtgtttttgataattttctg
gagtctggacatatttacagaggattacacaggggttacttttcccctaaggaggacttg
tattacacagagtctaagctaattaacgggaaatcacccctgggatttgatgtaacactt
gttgatgaaccggcttacttttttaaattagacatttggaagaggaaattagttgaattt
ttcaaggattctgaggtgattttacctcagcactcgcttaatgaggttaggaaattacta
cagtctgaaataaacgacattgccattaccagatccaattgtgactggggcataccaata
actaacagtgggaacgaaacagtttacgtatggtttgatgctcttttaggttatctaaca
catttacactcttttcccccactggaacagagtaactccaatcttaatgggttaaaaatt
attcatgtgattggtaaggacatcttaacatttcatactatcctgtggccagcaattttg
atggccttaaaattggatataaagttaagatttttagtacacggatggctcctgaacaag
ggtgaaaagatttccaaatccctcaacaactctatttcacccctgaacacatctgtgcca
tcagatgtctcgagatttgctctgatgaacttgggtgactttagttatgattttgagttt
gatccttcaatgtttgacaacgccttaaaaaccctcaggaataaatttgccaacactttc
tacagagttacatcaattctccagatgaataaagttgacactgttcagccctgtgattgt
gaccacaagctgttagaaaagtttaataaatattctgaagaaattagaaactctgtacaa
agctttaggttggacaggtatatacaaatattagtggaaatgtcttcggaggtgaacaag
tttattgagttgactcagttctggaccatgtcgtcacagtctgagttgttaaatacttcc
tggatttgctgcacacttttactttacatttccatttatttagctccaattacgcctaaa
ttagccaatgacatgattttaagattgggtccacagctaagtggagctccagtgaagaca
atttccttcaaccttttggacgatattcaacacatttcctacaatcccaaacatctcaac
cctctcatatag

DBGET integrated database retrieval system