KEGG   Theileria parva: TP02_0576Help
Entry
TP02_0576         CDS       T00254                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tpv  Theileria parva
Pathway
tpv00230  Purine metabolism
tpv01100  Metabolic pathways
Module
tpv_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tpv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TP02_0576
Enzymes [BR:tpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TP02_0576
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_22 ABC_tran AAA_18 SRPRB AAA_14 AAA_16 cobW ATPase_2 AAA_28 MobB NACHT NB-ARC Roc AAA_29 AAA_17 AAA_23 RsgA_GTPase RNA_helicase AAA_24 SRP54 Mg_chelatase AAA_5 T2SSE
Motif
Other DBs
NCBI-GeneID: 3501768
NCBI-ProteinID: XP_765142
UniProt: Q4N4R4
Position
2
AA seq 193 aa AA seqDB search
MSEDLPILVIVGPSGSGKTTLNARLIEDYPQVFENSISYTSRAMRPNERDGVHYNFVSKE
EFDQMYVDGEFVEFTTFVGFQYGTARSELERIQKLGKVPVLEIDIKGYKQLLDANLRLKG
VFIEPPGLEILRERLIKRGCNTEESINKRVERANQELEESRDCYFDARLPNEDLDVAYKE
FVNVLSQWYHIKP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggatttaccgattttggtgattgtgggcccttctggttctggtaagacaacg
ttgaatgcgaggttaattgaggattacccccaggtatttgagaactcaattagttataca
agccgtgcaatgcgtccgaatgagcgtgacggggtgcattataactttgtgtctaaggag
gaatttgatcaaatgtacgtcgacggcgagtttgtggagtttacaactttcgtgggattt
cagtatggaacagcccgatcagagctggaacggatacaaaaactaggcaaagtcccggta
ctggaaattgatattaaaggctacaaacaactgttagatgcaaatttgaggttaaagggc
gtgtttattgagccaccaggacttgaaatcttaagggaaaggttaattaaaagaggttgc
aacactgaggaatcgataaataaaagagttgaaagagctaatcaggaacttgaagagtca
agggattgctacttcgatgccagactaccaaacgaagatctggacgttgcatacaaggaa
tttgttaatgtcctctcacagtggtatcacatcaaaccataa

DBGET integrated database retrieval system