KEGG   Theileria parva: TP04_0739Help
Entry
TP04_0739         CDS       T00254                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit 8
  KO
K03252  translation initiation factor 3 subunit C
Organism
tpv  Theileria parva
Pathway
tpv03013  RNA transport
Brite
KEGG Orthology (KO) [BR:tpv00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    TP04_0739
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:tpv03012]
    TP04_0739
Translation factors [BR:tpv03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    TP04_0739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 3500825
NCBI-ProteinID: XP_764375
UniProt: Q4N1J6
Position
4
AA seq 951 aa AA seqDB search
MQSKFWGDDSDDSYSDSSEYSSKSDDKDNRRGVDANKWTLDSSDDEGESRIVKSAKAKAL
ETIQNHVKTIEHLRKINDYSELLKDYDILAKFVDKQYSSTRLPKLVVKMIVELSQFMEAQ
QKDKESYKKLSKAKTISFNTLRSRLRKFNEQHADIIEEYNKDPDNFYDVLQQSEDEDEES
TESSYSEWDEDEEEEAEEEAEAPEEKSPKSGDTSGWSDSGSHPTSEAEDGDKHNKAMDKW
GVKKAEARPEMVEKPKKTKTKAKKREVLEKQTPITSITKFSAVTAASDALVEYFKEVKLG
NDDNPFAVMIPEVQEMLDTVHLSEEALRLFVKSIVEKRGKRGTNNFENLKILQSLPYIAK
TISQSLYLEVLETLVHVLFDNYSHAYGAMTPTEWINTYRIASHLVSELISNPKSYLSSEM
VNSAQNNLMDDLDKANLDKLSAEKLNNVDKVKMMDDRVKTSLTVLSTIVQKLNDELYKGL
LYTEVHNPDYKTMLAYTIDMLYLLHRTLVYYLKFEKGNEFAATTALMILDHCHYKDDEIS
TKIWELVRNKIKDKKQTERFFPNENKKPSDLVTELVNFVFVYGTQREKIRACLHLAYNKS
LHGHYYEAKDLLAASNLTDVASETDISTQILVNRNLAQLGICAFRAGLISEAHSYLMDMC
VQNRHKELLAQGVSNLKNVEKTPEQERAEKRRLLPYHMHISIELIESVNYICALLLESAN
YVRYPLKAKEVISRQFRRMYDLYERQVFVGPPESNREVILNAFKHLQNGDWKQCFNFILS
LNTWNNMPDREKVQETLKELIKVEGFRTYIFKYVNIYDSFSVEQLSSMFSLDENVVHSLI
SKMIVNGEILGSWDYSSKCCLINHSEPTELQKLAVKLAENLSTAVEQNELTLNMKNSKFA
LSQDRRFQQRDTRYSYGSRHDDGRMSTFNFNRNRRFIQQPRQTKQFPVPTR
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcgaagttttggggtgacgattccgatgattcctactcagactcctctgagtac
tcaagtaagtctgatgacaaggataatagacgtggagttgacgctaacaaatggactttg
gacagttcggacgacgagggagagtcaaggattgtgaagtcagcaaaggccaaggctctg
gaaaccatccaaaaccatgttaaaaccattgaacacttgagaaagatcaatgattactca
gagttgttaaaggattacgatattcttgcaaaatttgtggataaacaatactcgtccacc
cgtttacctaaacttgttgttaagatgatagtggaactttctcagtttatggaggctcag
cagaaggacaaggaaagctacaagaagctctcaaaggctaagacaatctcgtttaacacg
ctgagatcaagactcagaaagttcaacgagcaacacgctgatattattgaggagtacaac
aaggaccctgacaatttctacgatgtgctccagcaatctgaggatgaagatgaggaatcc
actgaatccagctactctgagtgggacgaggatgaagaggaggaggctgaggaagaggct
gaggctcctgaagaaaaatcgccaaaatctggcgatactagcgggtggtcagactcgggc
tcccatcccacatcagaagctgaggacggagataagcataacaaggcgatggataagtgg
ggagtaaagaaggctgaggctcgaccggagatggttgagaagcccaagaaaaccaagact
aaggccaagaagcgtgaagttcttgagaaacaaacaccaataacgagtattaccaagttc
tcagcagtgactgcagcctcagacgcacttgtcgagtactttaaggaggttaagcttgga
aatgatgataacccattcgcagtgatgattcctgaggtccaagaaatgctagacactgta
cacttgagtgaggaggctctaaggttgtttgtaaaatcgatagttgagaagagaggaaag
aggggaacaaacaactttgaaaacctaaagatactccagtcgctgccttacattgcaaaa
acaatttctcagtcactgtaccttgaagttttggaaacactcgtgcacgtgctttttgat
aattattcacatgcctacggagccatgacaccaactgagtggattaacacctaccgaatt
gcctcacatctagtctcagaactcatcagtaaccctaaatcttatttatcatcagaaatg
gtcaattctgcccaaaacaatctaatggatgacttagataaggctaatctagataaactt
agtgctgaaaagcttaataatgtcgataaagttaaaatgatggacgacagagtgaaaacg
tcactgacagttttatcaacaatagtgcaaaagttaaatgatgagttatataaaggtttg
ctatatacagaagtgcacaacccagattataaaacgatgttggcgtatacaattgacatg
ttgtatttattacacaggacattagtttattatcttaagtttgagaagggcaatgagttt
gcagcaacaacagctctgatgattttagatcactgccactacaaggatgacgagatttcc
actaaaatctgggaactcgtcaggaataaaatcaaggataagaaacaaactgagaggttc
ttcccaaacgagaacaagaagccgagtgatctggttactgagcttgtaaactttgtattt
gtgtatggaacacaacgggagaagataagagcttgtctacatttagcatataataaatca
ctacacggccactattacgaggcaaaggaccttttggcagcatcaaatctaactgacgta
gctagtgaaactgatatttcaactcagattctggttaacagaaacttagctcagcttgga
atctgtgcctttagagcaggtttaatcagcgaagctcattcttacctcatggacatgtgt
gtgcaaaacagacataaagaattgttggctcaaggtgtgtcgaatttaaagaatgttgag
aaaactcctgaacaggaacgcgctgagaagaggagacttttaccctaccacatgcacatt
agcattgagctgattgagtcagttaactacatttgtgctttattgttagaatctgcaaac
tacgtaagatatcccctaaaggcaaaggaggttatttcaagacagtttaggaggatgtac
gacttgtatgagaggcaagtgtttgtagggcctccagagagcaacagagaagtaatttta
aacgcctttaagcacttacaaaacggtgactggaaacaatgttttaactttattttgtcc
ctaaatacctggaataacatgcctgatagggaaaaggtacaggagactttgaaagagctg
atcaaggtcgagggtttcagaacctacatcttcaaatacgtcaacatctacgattcattc
tcagttgagcaactctcctcaatgtttagcctcgacgaaaatgtagttcactccctaatc
agcaaaatgattgttaacggtgaaatactcggtagctgggactacagcagtaagtgctgc
ctcataaaccacagcgaacctactgaacttcagaaacttgcagtcaaacttgcagagaac
ctttctaccgcagttgagcagaacgaactaactctgaacatgaagaactccaagttcgcg
ctctctcaggacaggcgtttccagcaacgagacactcgctactcctacggctcacgtcat
gacgacggcaggatgtccaccttcaactttaatagaaaccgcagattcatccaacaaccc
agacaaacaaagcaattccctgtgcccacaagataa

DBGET integrated database retrieval system