KEGG   Theileria parva: TP04_0894Help
Entry
TP04_0894         CDS       T00254                                 

Definition
(RefSeq) glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
tpv  Theileria parva
Pathway
tpv00970  Aminoacyl-tRNA biosynthesis
tpv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpv00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TP04_0894
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tpv03029]
    TP04_0894
Enzymes [BR:tpv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     TP04_0894
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     TP04_0894
Mitochondrial biogenesis [BR:tpv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    TP04_0894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase DeoC
Motif
Other DBs
NCBI-GeneID: 3500661
NCBI-ProteinID: XP_764531
UniProt: Q4N155
Position
4
AA seq 470 aa AA seqDB search
MGLKCNLKIFKESRSYTESEINSYIEEFFQECSRLSGKPTHNSFENTKAWEYIKKCLESL
KNQEEVDPEILDKNEAYSYVLNKYQIFDQVVNLVERIKAEERDKIPLFGLPLAIKDNVAV
KGIPLKNGATTGPYEPSFTATAVESLINAGMVLVGKTKLNGFGLGANTTGVKSIYGEEYI
VGGSSGGSGVAVGGNSVTVAIGTDTGGSVRCPAAFCNAVGYRPSKGVVSRFGMHELSANF
DTVGFITNTVYEAVYLAYFTSGYDIKDMLSEYDSNLIKQSFLALLHNFNNLKIPLDMWKG
LKNVKIGMFDSEEIFKLGFIDEENKVNMENAARITSELGAEVIKLTIPPLDKLTAIYYLE
TAKQTTTNVRRFNQYPYSSNKSTTVTDLVLSFEKRIQERFLLGEYVKLSEFNIEGLLKDQ
REEMIKWVEENKLFSEVEFFITPSTSEVLPKKNIELQSKNVYMVRSIKSK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgggtctaaagtgtaatttaaagatctttaaggaatcaaggagttataccgagtctgaa
ataaatagttacattgaggagttttttcaggaatgttccagactatccggaaaaccaaca
cataattcatttgagaacacaaaagcctgggagtatattaaaaaatgtctggaatcacta
aaaaatcaggaggaagttgacccagaaattctcgacaaaaatgaagcctattcatatgtg
ttgaataagtatcagatatttgatcaggtagtgaatttggtagaaagaattaaggccgaa
gaacgggataaaatacccttgttcggtcttccacttgcaataaaggataacgtggcagtt
aaggggataccactgaaaaatggagccacaactgggccttatgaacccagtttcacggca
actgcagtagagtcacttattaacgcagggatggtactggttggtaagaccaaacttaac
ggttttggccttggggcaaatactacaggagttaagagcatttacggcgaagagtatatt
gtcggaggctcatcaggtggttcaggagttgcagtaggaggaaactccgttaccgtcgca
attggcaccgacactggtggttcagtcaggtgcccagcagctttttgcaatgcagtcggc
tacagaccctcaaaaggtgttgttagcaggtttggaatgcacgaactttcggcgaatttt
gacactgttggatttattacaaatactgtctatgaagcagtttatctagcttattttacc
tctggttatgatatcaaagatatgctaagtgaatatgattcaaaccttattaaacaatct
tttctcgctcttttacacaactttaacaacctaaaaataccgttggatatgtggaagggg
ttgaagaatgtaaaaatcggtatgtttgattccgaggagatttttaaattggggtttatt
gatgaggagaataaagttaatatggagaatgctgctagaataacctcagaattaggagca
gaggttataaaattaaccattccacccctggataagttgactgcaatttattacttggaa
actgcgaagcaaactaccactaacgttagaaggttcaatcaatatccttattcgtcaaac
aaatcaaccaccgttactgatttagtactaagttttgaaaaaagaatacaagaacgattt
ttactaggggaatatgtaaagctgagtgaatttaatattgaagggttgttaaaggaccag
agagaagagatgatcaaatgggtggaagagaataaactgttcagcgaagtggaatttttc
ataacaccgtcaacatcagaagtgttgccaaaaaagaatatagaattacaatctaaaaac
gtttacatggtaagaagtattaagtcaaaatga

DBGET integrated database retrieval system