KEGG   Turneriella parva: Turpa_0400Help
Entry
Turpa_0400        CDS       T02157                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tpx  Turneriella parva
Pathway
tpx00071  Fatty acid degradation
tpx00280  Valine, leucine and isoleucine degradation
tpx00281  Geraniol degradation
tpx00310  Lysine degradation
tpx00360  Phenylalanine metabolism
tpx00362  Benzoate degradation
tpx00380  Tryptophan metabolism
tpx00410  beta-Alanine metabolism
tpx00627  Aminobenzoate degradation
tpx00640  Propanoate metabolism
tpx00650  Butanoate metabolism
tpx00903  Limonene and pinene degradation
tpx00930  Caprolactam degradation
tpx01100  Metabolic pathways
tpx01110  Biosynthesis of secondary metabolites
tpx01120  Microbial metabolism in diverse environments
tpx01130  Biosynthesis of antibiotics
tpx01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Turpa_0400
   00650 Butanoate metabolism
    Turpa_0400
  Lipid metabolism
   00071 Fatty acid degradation
    Turpa_0400
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Turpa_0400
   00310 Lysine degradation
    Turpa_0400
   00360 Phenylalanine metabolism
    Turpa_0400
   00380 Tryptophan metabolism
    Turpa_0400
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Turpa_0400
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Turpa_0400
   00281 Geraniol degradation
    Turpa_0400
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Turpa_0400
   00627 Aminobenzoate degradation
    Turpa_0400
   00930 Caprolactam degradation
    Turpa_0400
Enzymes [BR:tpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Turpa_0400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFM11056
UniProt: I4B199
Position
complement(397517..398329)
Genome map
AA seq 270 aa AA seqDB search
MTTKPVLTQIHSTEGGKIYQITMNRPEVHNAVNGEMAKYLSEAWQKFRDDDALVVAVLHG
AGDKSFCAGADLTALGELAQLGEGMTPQAIERYAMNDAGPLGGSRIVQQKPVITVSHGYT
YAGGLELFCHGHIRIAEPQALFSVACRRWGVPLVDGGTVYLPRLLNWGAALPLIITGQRI
RAQRAYEIGLVWELAKKGKGLDRALKVAAQICQSPRDALIADLSSALNGSHLPLSEALRL
EARNLHPVATSESMKKGVERFNKGERFWAI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgaagccggttctcacacagatacactccaccgaaggcggcaagatataccag
attacgatgaaccgccccgaggtgcataacgctgttaacggcgaaatggcaaaatacctc
agcgaagcatggcaaaaatttcgggacgacgatgcgctggtcgtcgccgtcttacacggt
gcgggcgataaatcgttctgcgcaggggccgatctgacggcactcggcgaactcgcgcaa
ttgggcgagggcatgaccccgcaggcaatcgaacgatatgcgatgaacgatgctggccca
ttgggtggcagccgcattgtgcagcagaagccggtcatcacggtgagccacgggtataca
tatgcaggggggctcgagctcttctgccacgggcacattcgcatcgccgagccgcaggcg
ctgttttcggtggcctgccggcggtggggagttcccctcgtcgacgggggtaccgtctat
ttgccccggctgctgaattggggcgctgcgctgccgctgattatcaccggtcagcgtatt
cgcgcgcagcgtgcttacgagatcggcctcgtgtgggagctcgcgaaaaaaggcaaagga
ctcgaccgcgcgcttaaagtagcggcacaaatatgccagtcgccgcgcgatgcgctcatc
gccgatctttcatcggcactcaacggatctcacctgccgctcagcgaagcgctcaggctt
gaggcgcgcaatttgcatccggtagcgacgagtgagagcatgaagaagggcgttgagcgg
tttaacaagggtgaaagattttgggcaatctag

DBGET integrated database retrieval system