KEGG   Turneriella parva: Turpa_1897Help
Entry
Turpa_1897        CDS       T02157                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tpx  Turneriella parva
Pathway
tpx00010  Glycolysis / Gluconeogenesis
tpx00620  Pyruvate metabolism
tpx00640  Propanoate metabolism
tpx00680  Methane metabolism
tpx01100  Metabolic pathways
tpx01110  Biosynthesis of secondary metabolites
tpx01120  Microbial metabolism in diverse environments
tpx01130  Biosynthesis of antibiotics
tpx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Turpa_1897
   00620 Pyruvate metabolism
    Turpa_1897
   00640 Propanoate metabolism
    Turpa_1897
  Energy metabolism
   00680 Methane metabolism
    Turpa_1897
Enzymes [BR:tpx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Turpa_1897
Lipid biosynthesis proteins [BR:tpx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Turpa_1897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFM12544
UniProt: I4B5I7
Position
complement(1922227..1924212)
Genome map
AA seq 661 aa AA seqDB search
MAAKKPTVKKKQTEVIFDPKKIAPALVKTAHVKGMEGYKKLYNQSVKNPLAFWGKVGKEQ
LTWFKPFKQVLKSNFAKAENQWYVGGKTNLCYNALDRHLTTARKNKAAIIWEPDNPATPS
RTFTYQQLHFEVCRMANVLQANGVKKGDRVTIYMPMVPELAMATLACARIGAVHSIIFGG
FSADSIKDRIIDAGSDFVITTDTGYRGGKVIPIKAKVDEALEKMSGHVRKVLVVRHTGDH
VNVVAGRDIWWHEEAEKVSGVNKAAEIDSEDPLFLLYTSGSTGKPKGVLHTTGGYGVYAS
FTHKIVFDIQENDTYWCTADLGWVTGHSYILYGPLINGATSLMFEGIPTFPDVSRFWKVI
EKHQVSIFYTAPTAIRALMRFGDEPVKKHDLSSLRLLGSVGEPINPEAWLWYHRTVGRGK
CPIVDTWWQTETGGILISPLPGATPTKPGSATLPFFGVQPLLVDSDGKPLKGATEGNLCI
QFPWPSIMRGVYGDKERFYNTYFSTFKGYYFTGDGCRRDKDGYYWITGRVDDVMNVSGHR
LGTAEVESALVLHQDVAEAAVVGFPHDIKGQGIYAYVILKEGRIPSDDLRKELIAQVAKE
ISPIAKPDVIHFTPGLPKTRSGKIMRRILRKIAAGEIDTLGDTSTLADPAVVEILVKDRQ
K
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaaaaaccgacggtaaagaagaaacaaacagaagtgatttttgatccgaaa
aaaatcgcgcccgcgctcgtgaaaactgcgcacgtcaagggaatggaagggtataagaaa
ctctataaccagtcggtgaaaaatccattggcgttctggggcaaggtcggcaaagaacag
cttacctggtttaaacccttcaagcaggttttaaaatcaaactttgccaaggcagaaaac
caatggtatgtcggtggcaagacgaacctctgctacaatgcactcgaccgccacctcacc
accgcgcgcaaaaacaaagccgctatcatctgggagcccgacaaccccgccacaccttcg
cgcacgttcacataccagcagctgcatttcgaagtctgccgcatggcgaacgtgcttcag
gcaaacggcgtcaaaaaaggcgaccgcgtcacgatctacatgccgatggtgcccgagctc
gcgatggcgacgctcgcctgcgcgcgcatcggcgccgtgcactcgattatcttcggcggt
ttttctgccgactctatcaaagaccgtatcatcgacgcgggttctgattttgtcatcacc
actgacacaggctatcgcggcggcaaagtgataccaatcaaggccaaagtcgacgaggcg
ctcgaaaagatgtcgggccatgtgcgcaaggtgctcgttgtgcgccacacgggcgatcac
gtcaacgtcgtcgcaggccgtgacatctggtggcacgaagaagccgaaaaggtttcgggg
gtcaacaaagccgccgagatcgatagcgaagacccgctgtttcttctttatacctcgggc
tcaaccggcaaacccaaaggtgtgctgcacacgactggtggttatggtgtttatgcctca
tttacccataagattgttttcgacattcaagaaaacgacacctattggtgcacggcagat
ctaggctgggtaaccggccacagctacatcttgtacgggccactcatcaatggggcaact
tcgctcatgttcgagggcataccgacatttcccgatgtgagccgcttctggaaggtcatc
gaaaagcatcaggtttcgatattctacacggcgccgacggcgattcgtgcgctgatgcgt
ttcggcgacgagccagtcaaaaaacacgatctctcttcgctgcggcttctgggctcagtc
ggtgagcccattaaccccgaggcatggctgtggtaccaccgcactgtcggtaggggtaag
tgcccgatagtcgatacctggtggcagacagaaacggggggaatcctcatttcaccgctg
cccggcgcaacaccgacgaaacccggttcggcaacgctgccgttcttcggtgtgcagccg
cttttggtcgacagcgacggcaaaccgctcaagggcgcaaccgaaggcaatctctgcatt
cagtttccgtggccgtcgattatgcgcggcgtttatggcgacaaagagcgtttttacaac
acttacttctcgacgttcaaaggttattacttcacgggtgacggctgccgccgcgacaaa
gacggctattactggataaccggccgcgttgacgacgtcatgaatgtgagcggccatcgc
ctcggcacggcagaagttgaatcggcgctggtgctgcaccaagatgtcgccgaagcggcg
gtcgtcggctttccgcatgatatcaagggccagggcatttacgcgtatgtaattctgaaa
gaaggccgaataccgagcgacgatttgcgcaaagaactgattgcgcaggtcgcgaaagaa
atcagccccatcgccaaacccgatgtaattcacttcacgccggggttaccgaaaacgcgc
agcggcaagatcatgcggcgcattttgcgcaagatcgcggcgggtgaaatcgacacgctg
ggcgacacctcgacccttgctgaccctgcggtggtggagattctggtgaaagacaggcag
aaatag

DBGET integrated database retrieval system