KEGG   Turneriella parva: Turpa_1943Help
Entry
Turpa_1943        CDS       T02157                                 

Definition
(GenBank) Pyrophosphate-energized proton pump
  KO
K15987  K(+)-stimulated pyrophosphate-energized sodium pump [EC:3.6.1.1]
Organism
tpx  Turneriella parva
Pathway
tpx00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:tpx00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Turpa_1943
Enzymes [BR:tpx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     Turpa_1943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: H_PPase
Motif
Other DBs
NCBI-ProteinID: AFM12590
UniProt: I4B5N3
Position
1979117..1981576
Genome map
AA seq 819 aa AA seqDB search
MYKFRSIAGLFTSLLAVSVSPLMASEADLKIPDLASKTFLGGLDGRTLLILGLATCVLGL
VFGLIEFVRVKKLPVHKVMLEVSELIYETCKTYMLTQGRFLGILWIFIAAIMIYYFGFLA
QGGKDATGAVVHGYGVSKVLAILACSIVGIAGSYGVAWFGIRINTFANSRTAFASLTGKP
FDVHAIPLRAGMSIGVLLISVELLLLLGILLFIPPDFAGPCFIGFAIGESLGASALRIAG
GIFTKIADIGSDLMKIVFKIKEDDARNPGVIADCAGDNAGDSVGPTADGFETYGVTAVAL
ISLILLAVFPDFQVQLLVWIFSISVVMIFASLGSYYINALISNMKYKKAENFNFERPLST
LVWLTSIISVGCTYLVSYLIIPDLGGGTLWYKLASIISCGTLAGAVIPEVVKAFTSTESG
HVREVVTASKEGGASLNVLAGLTAGNFSAYWMGITIVALMGLSYYVSLQGLGQLMNPYAV
VVFAFGLVAFGFLSMGPVTIAVDSYGPVTDNAQSVYELSLIENVPNIKAEIKKDYGFDLN
FDKAKYFLEANDGAGNTFKATSKPVLIGTAVVGATAMIFSIIMMLTNNFNDQGAIAKLSL
LHAPFLLGLITGGAIIYWFTGASIQAVSTGAYRAVEFIKANIKLEGVEKASTKDSKAVVE
ICTKYAQKGMFNIFLGVFFSTLGFAFLNEYFFIGYLISIAIFGLYQAIFMANAGGAWDNA
KKLVEVELKQKGTPLHDACVVGDTVGDPFKDTSSVAMNPIIKFTTLFGLLAVELAVELKN
PDGSAAAIRGILAVAFFAASTFFVWRSFYGMRIKSEAAK
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaatttcgctcaatagctggtctttttacgagcctgcttgcggtttcagtttcg
ccacttatggcgagcgaagccgatcttaaaattcccgacctggctagcaagaccttctta
ggtgggcttgatggccgcacactgctgatactaggccttgcaacctgcgttctcgggctt
gtcttcggtctcattgaatttgtccgagtcaaaaaattgcccgtacataaagtcatgcta
gaagtttcagaactcatctacgaaacctgcaagacatatatgctcacccagggacgcttt
ctgggcattctgtggatttttatcgcggcgattatgatctactattttggctttctggcg
caaggtggcaaagacgcaactggcgctgttgttcacggctacggtgtttcaaaggttctg
gcaattctcgcctgctccatcgtgggtattgcgggcagctatggtgtcgcgtggtttggt
attcgcataaatacttttgctaactcgcgcactgcattcgcctcgcttaccggcaaacca
ttcgacgtgcatgcaataccactgcgggccggcatgtcaatcggcgttctgctgatttcg
gttgagctgctactcttactcggtattctgctgtttattccccctgactttgctggcccg
tgctttatcggctttgcaatcggcgaatcgctcggtgcttcagcgctgcggatcgcaggc
ggtatcttcacaaaaattgccgacatcggttctgacctcatgaaaattgttttcaaaatc
aaagaagatgatgcgcgcaaccctggggtaattgctgactgtgctggcgacaatgcgggc
gattcagtcggcccgacagctgatggttttgaaacctatggcgtcaccgctgtagctctt
atctcactcattctgcttgctgtgttccctgattttcaggtgcaattgctcgtttggatt
ttctcaatcagcgttgtcatgattttcgcttctctgggctcatattacattaacgcgctg
atctctaacatgaagtacaagaaagcagagaacttcaattttgaacgtcccctttcgaca
cttgtctggctgacttcaatcatttcagttggttgcacgtacctcgtttcatacctgata
attcctgatcttggcggcggcactctctggtacaagttggcaagtatcatttcatgcggt
accctcgctggcgcggtaatccccgaagtggtaaaagcttttacctcgactgagtcaggg
cacgtgcgcgaagtggtgactgcctctaaagaaggcggcgcgtcgctgaacgtgctcgcc
ggtcttacagcgggtaacttctctgcctattggatgggtatcacgatcgtcgcgcttatg
gggctgtcatattacgtgtcgcttcaggggcttggccagctgatgaacccctatgctgtt
gtagtctttgcattcggcctcgtggctttcggctttctcagcatgggcccggttacaatt
gccgtcgattcttacggcccggtaactgacaacgctcaatctgtttatgagctctcattg
atagaaaacgtgcccaacataaaggcagaaatcaaaaaagactacggattcgacctcaat
tttgacaaagccaaatactttctcgaagccaacgatggcgccggtaacacgttcaaagca
acatcgaagcccgtgctcattggtacggctgtcgtaggcgctacggccatgatcttctcg
attatcatgatgctgaccaataacttcaacgaccagggcgcaattgcaaaactctcgcta
ctgcacgcaccgttcttgctgggtctcatcaccggtggtgcgattatttattggttcaca
ggcgcttcgattcaagccgtatccaccggcgcgtaccgtgctgtggagtttattaaagcc
aacatcaagcttgaaggtgtcgaaaaagcttcgacaaaagacagcaaagcggtggttgag
atttgcacaaagtacgcacagaaaggtatgtttaacatctttcttggggtattcttcagt
acgctgggctttgcctttctgaacgaatacttcttcatcgggtacctcatctcgatcgcg
atcttcggtctttaccaggcaatcttcatggccaacgccggtggcgcttgggataacgcc
aagaaacttgtcgaagtcgagctgaagcagaagggtacacccctgcacgatgcctgcgtt
gtgggcgatacagtcggcgacccgttcaaagacacttcatcagtggcaatgaacccgatc
attaagttcacgactctctttggcctgctcgcggttgaacttgccgttgagctgaaaaac
cccgatggttcagctgctgctattcgcggtattctcgcagttgcgtttttcgctgcgagc
actttctttgtctggcgctcattctacggaatgcgcatcaaatcagaagccgcaaaataa

DBGET integrated database retrieval system