KEGG   Turneriella parva: Turpa_1944Help
Entry
Turpa_1944        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFM12591
UniProt: I4B5N4
Position
complement(1981643..1982548)
Genome map
AA seq 301 aa AA seqDB search
MAKARKSTASDARFEEFLQEQFKQLRAELDKFEPTRNGVDGKLLQLPQSKAAGSTFWKKV
DSWRYGIAASVLLAVAVPTVIQMNREQRSAVVQATSPMTEKAAENKPDRPTGTVIPETDH
VEREEADESRPSVARKKSTAPKLAASKPTPTKEAADLREQKDAAGGMAKREIPEDVMAAA
EAAPIAKGRALASVGERAPREESPRAVPVAPAAPAMADKAEEKKSANVASRSAPIPDAQF
KLKQERIAEEEKAEMEKLWKEFEKDPKAFHQDAKRSARLRTLLARHDTKARARRLKTELA
Q
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaggcgcgaaaatcaacagcaagcgatgcccgctttgaagaatttctgcaagaa
cagtttaagcagctgcgcgcagaactcgacaaattcgaacctacacgcaacggcgtagac
ggtaaactgctgcagctgccgcaatcgaaggcagcgggttcgactttctggaaaaaagtg
gattcatggcgttatggcattgcggcatctgtgttgctcgctgtagccgtgccgaccgtg
attcaaatgaatcgtgagcagcgtagcgcagtcgttcaggccacgagtccgatgactgaa
aaagcagctgaaaacaagcccgatcggccgacaggcactgtaatcccagagacggatcac
gtcgagcgcgaagaggccgacgagagccggccatcggtagcacgcaagaaatccacagca
ccgaaattggcagccagcaagcctacaccaacgaaagaagcagcagacctgcgcgagcag
aaagacgctgctggcggtatggcaaaacgcgaaatacctgaagacgtgatggcggccgcc
gaggctgcaccgatagcgaagggccgcgcactggcgtctgtaggcgaacgagcgcctcga
gaagaaagcccgcgcgcagtgccggttgcaccggcagcacccgcaatggccgacaaggca
gaagaaaagaagtctgcaaatgtggcgagccgatcggcaccgatacccgatgcccagttt
aagttaaagcaagaacgtatagccgaagaagaaaaagccgaaatggagaaactctggaaa
gagtttgaaaaagacccgaaggcgtttcaccaagatgcaaagcgcagcgcccgactcaga
accctgctcgcccggcatgacacgaaggcgcgcgcgcggcggctgaaaactgaactagcg
caataa

DBGET integrated database retrieval system