KEGG   Turneriella parva: Turpa_1945Help
Entry
Turpa_1945        CDS       T02157                                 

Definition
(GenBank) RNA polymerase, sigma-24 subunit, ECF subfamily
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
tpx  Turneriella parva
Brite
KEGG Orthology (KO) [BR:tpx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:tpx03021]
    Turpa_1945
Transcription machinery [BR:tpx03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Turpa_1945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4_2 Sigma70_r2 Sigma70_r4 Sigma70_ECF HTH_AsnC-type HTH_24 TnsD HTH_30 HTH_Tnp_ISL3 HTH_40 HTH_28 LUC7 DUF1492 HrcA_DNA-bdg
Motif
Other DBs
NCBI-ProteinID: AFM12592
UniProt: I4B5N5
Position
complement(1982541..1983119)
Genome map
AA seq 192 aa AA seqDB search
MYLLKLVTIAFAAIASADFMARLMPYRDRLFRLALAQLRNTSDAEDAVQEALIKAGRNAQ
QFRSESSEYTWVVRILINHCHDVQRKVTRRQKREVSGEISEAKGATIADTRASTEQNIEL
SEMSQHLMDAVNELGQNYKPLILMRYFESMSYEDIAEALGLNTGTVKSRMNQAKALLRAK
LEKLGIGEDYFG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtacctgcttaagcttgtcaccattgctttcgctgcgattgcctcagcagacttcatg
gcgcgtctcatgccctaccgcgaccgcctgtttcggcttgccctcgcgcagctgcgtaat
accagcgacgccgaagatgcggttcaagaagccctgatcaaggcggggcgcaatgcgcag
caatttcgcagcgaatcgagcgaatatacctgggtcgtgcgcattctcattaatcactgc
catgatgtgcagcgcaaggtgacgcgacggcaaaagcgcgaggtttcgggcgaaatcagc
gaagccaagggcgcaacgattgccgacacgcgggccagcaccgaacaaaatatcgaactt
tctgagatgtcgcagcatctaatggatgcggtgaatgaattgggccaaaactataagcca
ctgattttgatgcgctattttgagagcatgagctacgaagacattgctgaagcgctgggc
ctgaacacgggtacagtcaagtcgcgaatgaatcaggccaaggcgctgctcagggccaaa
ctcgaaaagctcggtatcggagaagactactttggctaa

DBGET integrated database retrieval system