KEGG   Turneriella parva: Turpa_1947Help
Entry
Turpa_1947        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_16 TPR_12 TPR_19 TPR_2 Wzy_C_2 DUF247 TPR_10
Motif
Other DBs
NCBI-ProteinID: AFM12594
UniProt: I4B5N7
Position
1983577..1985058
Genome map
AA seq 493 aa AA seqDB search
MPEAVVKFVQQNQPWVVAAGIGLLLFVAAIVILVVALKRARGPRPEQAVKVAASAPATTQ
TPPEVAQPRVRRARLSVGDTPSPWTQGVYERHSPEAKLARILPAFGFDIAGTIHRSQNAE
FVDATELAATLRYCNTAVGVGVHGAYATLLLWHVGDPHYATMVLKVVSHAQLAHQEKALI
RFLFQDITGHPFAPQDLPKPTGRQNPAFQASISLYTEPHISTQRWLELQQQLPAELRPYH
QIEVSRKSPARVMYRESPTNPLFADALFHQNLSTLSRYMSTKRWQRLMQSGKAEQFRNWL
GAQKIDSVCKALLFIADPEVYEKEDLSPELRREIVTLLDEQNVREWLFQGGRMPPLAERR
QYFKFFCLFGRHGEAVRCFATLGAFRRDRALRLYYARALFSGEMLHEAWAEMSSLLADYP
RDAAVLNEAGIYAHRLGRYEEAAQIFATARGMFPDDATIAYNEAVFTEQYSKLQVEAKWS
AVQKLTAPPVIEA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagcagtcgtcaaatttgttcagcagaaccaaccatgggtggttgcagcaggc
atcggtctgctgctctttgtcgcggccatcgttatactcgtcgtggcgctcaagcgggcc
cgtgggccccgacccgaacaagctgtgaaggtggccgcaagcgccccggcaaccacccag
actccgccagaggtggctcagccccgtgtcaggcgcgcgcggctttcggtcggtgatacc
ccaagcccgtggactcaaggcgtttacgaacgccattcacccgaggcaaagctcgcgcgc
attctgcccgccttcggttttgacatcgcaggcaccatacaccgttcgcagaatgctgaa
tttgtcgatgccactgaacttgcggcgactctgcgctattgcaatactgccgtgggggta
ggtgtgcacggtgcgtacgcgacgctgctcttgtggcacgttggtgatcctcattatgcg
acgatggtactcaaagttgtcagccatgcgcaactcgcccatcaagaaaaggctctgatt
cgctttctgtttcaagacatcaccggacaccctttcgcacctcaagacctgccgaagccg
acgggacgacagaacccggcttttcaggcatccataagtctctataccgaaccgcatatt
tcgacacagcgatggttagagttgcagcaacaattacccgctgagctgcgaccgtaccac
cagattgaagtctcacgcaaatcgcctgctcgggtcatgtaccgtgagtcgccgactaat
ccccttttcgccgatgcgctctttcaccagaatctttcgacgctgagccgttacatgagt
acgaaacgctggcagcgtctcatgcagtcgggcaaagcggagcagtttcgcaactggctg
ggcgcgcagaaaatagactcggtgtgcaaggctctgctctttattgctgacccggaagtc
tacgaaaaagaagacctgagccccgaactccgccgcgagatcgtgacgctgctcgacgag
caaaacgtgcgcgagtggttgtttcagggggggcgtatgccgccgctggccgaaaggcgc
cagtacttcaaattcttttgcctctttggccgccacggagaggccgtacgctgcttcgca
actctcggcgcgtttcgccgcgaccgcgcgctgaggctctactacgcccgcgcacttttt
tccggcgaaatgctgcacgaagcatgggcagagatgagttcgctgctcgccgactatccg
cgcgacgcagcggtcttgaacgaggccggcatctatgcgcaccggctgggccgctatgaa
gaagcagcgcagatcttcgcaacagcgcgtggtatgtttcccgacgatgcgacgattgcc
tacaacgaagcggtcttcactgaacagtacagtaaattgcaggtagaagcgaaatggtct
gctgtacagaagttgacagcgcccccggtcatcgaagcatga

DBGET integrated database retrieval system