KEGG   Turneriella parva: Turpa_1949Help
Entry
Turpa_1949        CDS       T02157                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tpx  Turneriella parva
Pathway
tpx00071  Fatty acid degradation
tpx00072  Synthesis and degradation of ketone bodies
tpx00280  Valine, leucine and isoleucine degradation
tpx00310  Lysine degradation
tpx00362  Benzoate degradation
tpx00380  Tryptophan metabolism
tpx00620  Pyruvate metabolism
tpx00630  Glyoxylate and dicarboxylate metabolism
tpx00640  Propanoate metabolism
tpx00650  Butanoate metabolism
tpx00900  Terpenoid backbone biosynthesis
tpx01100  Metabolic pathways
tpx01110  Biosynthesis of secondary metabolites
tpx01120  Microbial metabolism in diverse environments
tpx01130  Biosynthesis of antibiotics
tpx01200  Carbon metabolism
tpx01212  Fatty acid metabolism
tpx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Turpa_1949
   00630 Glyoxylate and dicarboxylate metabolism
    Turpa_1949
   00640 Propanoate metabolism
    Turpa_1949
   00650 Butanoate metabolism
    Turpa_1949
  Lipid metabolism
   00071 Fatty acid degradation
    Turpa_1949
   00072 Synthesis and degradation of ketone bodies
    Turpa_1949
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Turpa_1949
   00310 Lysine degradation
    Turpa_1949
   00380 Tryptophan metabolism
    Turpa_1949
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Turpa_1949
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Turpa_1949
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Turpa_1949
Enzymes [BR:tpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Turpa_1949
Exosome [BR:tpx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Turpa_1949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III Ketoacyl-synt_C ketoacyl-synt SpoVAD DUF4751
Motif
Other DBs
NCBI-ProteinID: AFM12596
UniProt: I4B5N9
Position
1986771..1987952
Genome map
AA seq 393 aa AA seqDB search
MREVYIIGAHETEHGSFKEKNFRHLIAEAGNGAIHDAGIDRKEIQALYLGNYNGNGLNNQ
NTMAALAATSIGMPHAATLRFEAACASGGVAFRNAMIAVGAGVYDTVMVMGVEKMNVPPE
ELPYEDQMKAALSGVDYLYEAGSGMNGSTMFAMFAHRHMHEFGTTRLQLAQVAEKNKYHG
SLNPYAYKQREIPLEKILKSPMIASPFSAQEVSLITDGAAAVIITTKDRAKALGKKNAVK
VMGSGHGGASFSVAFRAKHTESEATKAAAAEAYKMANLKPSDISVAECHDCFSFTEIMNV
EDLGFTEKGKGGFFAAEGHSRLGGKLPINTSGGLTAKGHPIGATGVGQIVEMTWQLQDKS
DKRQVKDAKFALTHVLGGPASVSTVHILGRGDI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagtctacatcatcggtgcgcatgaaaccgaacacggaagttttaaagaaaag
aactttcgccatctgattgccgaagccggtaacggggctatccacgacgcaggtatcgac
cgcaaagagattcaggcgctctacctgggtaactataacggcaacggtctcaataaccag
aataccatggcggcgcttgccgcgacctcgatcggtatgccgcacgcggcgacgctgcgt
tttgaagcggcctgcgcatcgggcggagttgcctttcgcaatgcgatgatcgctgtgggt
gcaggcgtctatgacaccgtgatggtgatgggcgtagagaagatgaacgttccccccgaa
gaattgccttacgaagaccagatgaaggccgcgctctcaggtgtggattatctgtatgaa
gccggttcgggcatgaacggttcgaccatgttcgcgatgttcgcacaccgccacatgcac
gagttcggcaccacccgcctgcagctggcacaagttgcagaaaagaacaagtaccatggt
tctctgaatccttacgcttacaaacagcgcgaaattccactcgaaaaaattctgaagtcg
ccgatgattgcatcgcccttcagcgcgcaagaagtctcgctgattaccgacggcgcggct
gcggtgattatcacgaccaaagaccgtgcgaaagcactcggtaaaaagaatgcggtgaaa
gtcatgggctcgggccatggcggtgcgtcgttcagcgttgcgtttcgcgcaaagcacacc
gaatcagaagcgacaaaggccgcagcggccgaggcttataagatggcgaacctcaaaccc
tctgacatctcggttgctgagtgccacgattgcttcagctttaccgaaatcatgaacgtc
gaagacctcggttttaccgaaaaaggcaaaggcggattttttgcggcagaaggccattca
cggctcggcggcaaattacccatcaacacatcaggtggcctcaccgccaagggacatccg
atcggtgcgacgggtgtcggccagatcgttgagatgacctggcagcttcaggataaatct
gacaaacgccaggtgaaagatgcgaagtttgcactgacgcacgttctcggtggccccgca
tcggtttcaacagttcacattttgggaagaggtgatatatga

DBGET integrated database retrieval system