KEGG   Turneriella parva: Turpa_1950Help
Entry
Turpa_1950        CDS       T02157                                 

Definition
(GenBank) protein of unknown function DUF35
  KO
K07068  uncharacterized protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OB_aCoA_assoc DUF35_N DZR zinc_ribbon_2 zf-ribbon_3 HypA Zn-ribbon_8 Phage_TAC_10
Motif
Other DBs
NCBI-ProteinID: AFM12597
UniProt: I4B5P0
Position
1987949..1988299
Genome map
AA seq 116 aa AA seqDB search
MNTSGELGRTIPAVKCKDCGTPHPKGIAACPACGSMNLEDYEARGTGAIYTYSVNTFVPM
GKHKARAPYCMAVVETDDKMRITAIVEMPDANTAKIGDKVQFKAYEDKLTPIFERV
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgaacactagtggtgagcttggtcgaaccataccagccgttaaatgcaaagactgcggt
acgccgcacccgaaaggtatcgccgcatgccctgcctgcggttcgatgaacctcgaagac
tatgaggcaagaggcacgggggcgatctacacgtactcggtgaacacgttcgtgccgatg
ggcaagcacaaggcgcgtgcgccctactgcatggccgtcgtcgaaacggatgacaagatg
cggatcacggcaatcgtcgagatgcccgacgcgaataccgcaaagatcggcgacaaggtg
cagtttaaggcatacgaagacaaactgacgcccatatttgaaagggtctaa

DBGET integrated database retrieval system