KEGG   Turneriella parva: Turpa_1953Help
Entry
Turpa_1953        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHD_like HicB_lk_antitox
Motif
Other DBs
NCBI-ProteinID: AFM12600
UniProt: I4B5P3
Position
1990355..1990588
Genome map
AA seq 77 aa AA seqDB search
MDLSIRVYEKDGEFVASCPELDVYTYGQNAEQARARLKHVIAFYADTAQDLGYKIDATEL
LSSFQKPAQARTESFLN
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgagcatacgcgtatacgaaaaagacggagagtttgtggcttcatgccctgag
ctcgatgtgtatacctatggccagaatgccgagcaggcacgcgcgcgcctcaagcatgtc
attgctttttatgcagacacggcgcaagacctcggttacaaaatcgacgcgaccgaactg
ctctcgagttttcagaagcctgcacaggcgcgcacagaatcttttctgaattaa

DBGET integrated database retrieval system