KEGG   Turneriella parva: Turpa_1954Help
Entry
Turpa_1954        CDS       T02157                                 

Definition
(GenBank) cell cycle protein
  KO
K03588  cell division protein FtsW
Organism
tpx  Turneriella parva
Brite
Chromosome and associated proteins [BR:tpx03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Turpa_1954
Transporters [BR:tpx02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Turpa_1954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTSW_RODA_SPOVE
Motif
Other DBs
NCBI-ProteinID: AFM12601
UniProt: I4B5P4
Position
complement(1990621..1991748)
Genome map
AA seq 375 aa AA seqDB search
MRHERAGFNAARQSTQVNPTDLFLFGLIIALVVFGLNILLASSSFMAREQFSDPYFFLKK
QAFAAFIGFLGMVAMTQIDLENFRHWVWPIYAVTLVLLVLVFVPGIGRRAGGANRWIVIA
GLSIQPSDFAKIALILVLARVYSQATEVDLRLSFTTLGLIVLPAFLIAIEQDLGTAIHLV
LVALSLLFFTRYPLTMQFAALGAAVATVAYVILKTPFRLSRIKAFLDPWEARYDAGFQLV
ASMKAFLAGGLTGRGLGEELVRHHLQERHTDFILAIVAEDLGALGVIFLLATYFVIGVYG
IVLASRLRDTFMRLVATGILLSLIIQVTINSGVTMGLLPTKGINLPLVSNGGTSLVVYLV
MCGMLLSALRREQTA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
ttgagacacgaacgggccgggttcaacgccgcgcggcaaagtacgcaggtgaaccctact
gatctttttcttttcggtctgatcattgcgctcgtggtgttcggcctcaatattctgctt
gcttcgtcatcattcatggcgcgcgagcagttcagcgacccttatttctttttgaagaag
caggctttcgcagcgttcatcggttttctcggcatggttgcgatgacgcagatcgacctc
gaaaattttcgccattgggtttggccgatctatgccgtgaccctcgtgctgctcgtgttg
gtttttgtgcccggcatcggccgacgggcgggcggcgctaaccggtggattgtcattgca
ggcctttctattcagccgtcagactttgcgaaaattgcactcattcttgttttggctcgc
gtctactcgcaggcaactgaggtagaccttcgcctcagcttcacgactctcgggttaatt
gtgttgccggcatttctcatcgcgatcgaacaagatctcggcacagcgattcacctcgtg
ctggtggcattaagcctgctattcttcacgcggtacccgctgacgatgcagttcgccgca
ctcggggccgcggtcgcgacagtcgcgtacgttattctgaagaccccttttcgactcagc
cgcatcaaggcgtttctcgacccatgggaagcacgctacgacgcgggctttcagctcgtc
gcctcgatgaaggcgtttctcgccggcgggctcaccgggcgaggcctcggcgaagaactg
gtgcgccaccatctgcaagagcgccataccgacttcattctggcaatcgtcgccgaagac
ctgggcgcgctcggcgtcatatttctactcgcgacctactttgtcatcggcgtatacggt
attgtgctggcctctcggctgcgcgacacgttcatgcggctcgtggccacaggtattttg
ctgagcctgattattcaggttactatcaacagcggcgtcacaatggggctcttgccgaca
aaaggcatcaacctgccacttgtgtcaaacggtggcacctcgctggttgtctatctggta
atgtgcggtatgcttctcagcgcactgagaagagaacaaaccgcttga

DBGET integrated database retrieval system